KEGG   Phalaenopsis equestris: 110029954Help
Entry
110029954         CDS       T05601                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 3-like isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
peq  Phalaenopsis equestris
Pathway
peq00010  Glycolysis / Gluconeogenesis
peq00030  Pentose phosphate pathway
peq00051  Fructose and mannose metabolism
peq00052  Galactose metabolism
peq01100  Metabolic pathways
peq01110  Biosynthesis of secondary metabolites
peq01200  Carbon metabolism
peq01230  Biosynthesis of amino acids
peq03018  RNA degradation
Module
peq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110029954
   00030 Pentose phosphate pathway
    110029954
   00051 Fructose and mannose metabolism
    110029954
   00052 Galactose metabolism
    110029954
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    110029954
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:peq01009]
    110029954
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:peq03019]
    110029954
Enzymes [BR:peq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     110029954
Protein phosphatases and associated proteins [BR:peq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110029954
Messenger RNA biogenesis [BR:peq03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     110029954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 110029954
NCBI-ProteinID: XP_020588113
LinkDB All DBs
Position
Unknown
AA seq 584 aa AA seqDB search
MESMSNSLVSQKSHRSLGLRSPICPTNAIPDRKLRLRRGRAMAPEFGNMRKLVHGESGYV
LEDVPHLSDYVSGLPTYPNPLQDNPAYSVVKQYFVNVDDTVAQQIVVHKSSPRGTHFRRA
GPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLAYMYGVSKILGIEGGYKGFYAR
NTLPLTPKSVNDIHKRGGTILGTSRGGHATSKIVDSIEDRGINQVYIIGGDGTQKGASVI
FEEIKRRGLKVSVVGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESIEHGIGV
VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGNGGLFEFIEKRLKENGHMVIVVAE
GAGQELIAESMRSMDHEDASGNKLLQDIGLWLSQKIKHYFSSKKKMIINLKYIDPTYMIR
AVPSNASDNVYCTLLAQSAVHGAMAGYTGFTVAPVNGRHAYIPFYRITETQNKVVITDRM
WARLLSSTNQPSFLSQNAIEDAKKEDVPPTQLLDGENGFKKSNHELSFSPNLPNFLSHNG
TDDAEKENEPPTLLPEAHIYCKAQLCDNGVANKTSGLSTPDHLV
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggaatccatgtctaattccttagtttctcaaaaatcacaccgcagcttgggtttaagg
agtccgatttgtcctactaacgcgattcctgacaggaaacttaggcttcgacgtggtagg
gcgatggccccggagtttgggaatatgcggaagcttgtccatggagaatctggttatgtg
ctggaggatgtgccgcacctttcggattacgtttctggcttgcctacatatccgaatcct
ctccaggataatccagcatattcagttgtgaagcagtattttgtcaacgtcgatgataca
gttgcacagcagattgtggttcacaagagcagccctagagggacccattttcgacgtgct
gggcctcgccaaagggtttattttgagtcagatgaggtacatgcttgcattgtaacctgt
ggtggcctctgccccggccttaatactgttattagggagatagtttgtggcttggcatat
atgtatggtgtttccaagatccttggaatagagggtgggtacaaaggtttttatgctcgc
aatactcttcctttgactcctaaaagtgtcaatgatattcataaaaggggaggcactata
ctgggaacatcacgagggggccatgccacttcaaagatagttgatagtattgaagatcgt
ggtatcaatcaggtctatattataggaggggatggaactcagaagggtgcctccgttatt
tttgaggaaattaaaaggcgtggcctcaaagtttctgttgttggcatccccaagacgatt
gataatgacatagcggtaattgacaaatcatttggtttcgatactgctgttgaagaagca
caacgggctattaatgctgcgcatgttgaagctgagagtattgaacacggaatcggtgtt
gtcaagctgatgggtcgctacagtgggttcattgcaatgtatgcaactctcgcaagcaga
gatgtggactgttgcctgattcctgagtcacccttttatctggaaggaaatggtggcctt
tttgaatttatagagaagagactcaaagagaatggccacatggttattgttgttgctgaa
ggagcgggacaagagcttattgctgaaagcatgcgctcgatggatcatgaagatgcttct
ggaaataagctgcttcaagatatcggcctatggttatctcagaagatcaagcactacttc
tcgagcaagaagaagatgatcataaatctcaagtatattgatccaacatacatgatccgt
gcagttcccagcaatgcttctgataacgtgtactgcactttgttggctcagagtgctgta
cacggtgcaatggcaggttatactggttttacagtggcgcctgttaatggcagacatgct
tatattccattttacaggatcactgaaacgcaaaacaaggttgtaattacagacagaatg
tgggcaaggctgctctcttcaacgaaccaaccaagctttctgagtcaaaacgccattgaa
gatgcaaagaaggaagatgtgccaccaactcagttgttggatggggaaaatggttttaag
aaatccaaccatgagctttctttttcgcccaacctaccgaactttctgagtcataatggc
accgatgatgcggagaaagaaaatgagcctccaactctgcttcctgaagcacacatttat
tgcaaagcacaactctgtgataatggcgtagcaaacaaaacttccgggctatcaacgcca
gaccatctagtttga

DBGET integrated database retrieval system