KEGG   Phalaenopsis equestris: 110030485Help
Entry
110030485         CDS       T05601                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
peq  Phalaenopsis equestris
Pathway
peq00040  Pentose and glucuronate interconversions
peq00051  Fructose and mannose metabolism
peq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110030485
   00051 Fructose and mannose metabolism
    110030485
Enzymes [BR:peq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     110030485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Sacchrp_dh_NADP AlaDh_PNT_C 2-Hacid_dh_C FAD_binding_2 UDPG_MGDP_dh_N ThiF Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 110030485
NCBI-ProteinID: XP_020588872
LinkDB All DBs
Position
Unknown
AA seq 358 aa AA seqDB search
MGKGGDGGEENMAAWLLGINDLKVLPYKLPPLGPNDVRVRMKAVGICGTDVHYLKTMRMT
HYVVKEPMVIGHECAGIIEELGSEVKSLAVGDRVAIEPGMTCGRCKYCRAGRYNLCDDTK
SLGLPPVHGSLANQLVHPADLCFKLPDNVNLEEGAMCEPLSVGVHACRRAGINPETTVLI
VGAGTIGLVTMFTARAFGSPRIVIADVDEQRLSIAKSLGADEFVKVSPDIKDVDEEVELI
KKAMGCDIDVTFDCAGFSKTMSTALNATRTAGKICLVGMGHNELTIPITPAVAAREVDII
GAFRYKETWPLCIELIRSGKIDVKPLITHRFGFSQKEVDEAFKVSARGGNAIKVMFNL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaggcggagatggcggagaagagaacatggcagcatggcttcttggcattaac
gatctgaaggtcctgccttacaagctcccgccactaggtcctaatgatgttcgtgtgcgc
atgaaagctgttggcatttgtggcactgatgtccattacctgaagactatgaggatgact
cattatgttgtcaaagaacctatggtgattggacatgagtgtgctggaattattgaagag
ttgggaagtgaagtgaaatctcttgctgtgggtgaccgtgttgccatagaacctggaatg
acctgtggccgctgcaagtattgcagggctgggcgctacaatctatgtgatgacacaaag
tctttaggccttccaccagttcatggctctcttgctaatcagctggtgcatcctgctgat
ctttgcttcaagcttcctgacaatgtgaacttggaggaaggggccatgtgtgagcccctt
agtgttggtgtacatgcttgcaggagagctggcattaatccagagacaactgtgctcatt
gttggggctggaactataggattagtcacgatgtttaccgcacgtgcctttggatcccca
agaattgttatagctgatgttgatgaacagcgcctttcaattgcgaaatctcttggtgca
gatgaattcgtcaaggtttctccagatattaaggatgtagatgaggaagttgagctgata
aaaaaagctatgggttgtgatattgatgtgactttcgattgtgctggctttagcaaaacc
atgtccactgctctgaatgctactcgcacggccggcaagatttgtcttgtgggcatgggc
cacaatgagctgaccattcctataactcctgctgtcgcagcaagagaagttgatattatc
ggcgcgttccgctacaaagaaacttggcccctatgcattgaactaataaggtctgggaaa
attgatgtgaagcctttgataactcaccgatttgggttttctcagaaggaggtcgacgaa
gcgttcaaagttagcgcgcgtgggggcaatgcaattaaggtcatgttcaacctctag

DBGET integrated database retrieval system