KEGG   Phalaenopsis equestris: 110031283Help
Entry
110031283         CDS       T05601                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
peq  Phalaenopsis equestris
Brite
KEGG Orthology (KO) [BR:peq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:peq01001]
    110031283
Enzymes [BR:peq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110031283
Protein kinases [BR:peq01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   110031283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH Pkinase_C RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 110031283
NCBI-ProteinID: XP_020590064
LinkDB All DBs
Position
Unknown
AA seq 478 aa AA seqDB search
MVSSGISGLTRTCNQKFRNMKVLLPMGPSDSIPNDHEIDFSVVFGPIPVEPSVEINGLAS
NNFVPRRASDGKNYDSPLVLRNRSHALVGPSQITQLLQHTSLETNSLRDLGACSTVKTEV
QQEKTRSNDAAEKDNQTKEVSGVGLEDFEVLKLVGRGAFGKVFQVRKRDTSEIFAMKVMR
KDKIIEKNHAAYMKAERDILTKIDHPFIVRLRYSFQTKYRLYLVLDFVNGGHLFFQLYHE
GLFREDLARIYAAEIVSAVSHLHANGIMHRDLKPENILMDADGHVLLTDFGLAKEFNGND
RSNSLCGTVEYMAPEIITGKGHDKAADWWSVGILLFEMLTGNPPFVGGNRDKIQQRIVKE
KMKLPFYLSAQAHSLLKGLLQKEASKRLGNGPGGSNDIKNHKWFKSINWKKLEAREIQPS
FRPNVADQLCIANFDKKLTSMPLLDSPVASPVAGDDVFVNFSYVRPSTFLQKQSLLQS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggtttcctctggtatatctggtttgaccagaacttgtaatcagaagttccgcaacatg
aaagtacttttaccaatgggcccatccgattccattccaaacgaccacgaaattgacttt
tctgttgtttttggtcccataccagtcgaaccatcagtcgaaatcaacgggctggcctcc
aataattttgttccaaggagagcttctgatggaaaaaattatgattctccgttagtcctt
agaaatcggtctcatgctcttgtcgggccttctcaaattacacagctgctgcagcacact
tcgcttgaaacgaacagtttaagggatcttggagcgtgctccacagttaagactgaagtt
caacaagagaagacacgcagtaatgatgctgcagagaaagataaccaaacaaaggaggtt
tcaggagtgggacttgaggattttgaagttttgaaactagtcggacggggggcttttggt
aaagtttttcaggtgaggaaaagggacacttcggaaatatttgcaatgaaggttatgaga
aaggataagataattgaaaagaatcatgctgcgtacatgaaagccgagagggatatattg
acaaaaattgaccatccatttattgttcggctcagatattcctttcagacaaaataccga
ttgtatctggtgctggattttgttaatggggggcacctattctttcagctatatcatgag
ggtttattcagagaggatttggcaagaatatatgcggctgagatagtttctgctgtctcc
caccttcatgcaaacgggataatgcacagagaccttaagcctgagaacatccttatggat
gctgatggccatgtgctgctcactgattttgggcttgcgaaggaatttaatggcaatgat
agatcaaactctctgtgtgggacggtagaatacatggcgccggagattatcaccggaaaa
ggccatgataaggctgctgattggtggagcgttggaattctgctatttgaaatgcttaca
ggaaacccaccatttgttggaggaaatcgagataaaattcagcagagaatagtgaaggag
aagatgaagctccctttttatttatccgctcaagcccattccctcttaaaaggactgctg
caaaaggaagcgagcaagaggcttgggaatggacctggtggcagcaatgacataaagaat
cataaatggttcaaatccataaactggaagaaactcgaggcaagggagatacaacccagt
ttcaggccgaatgtcgccgaccaattatgcattgcgaatttcgataagaagttgactagc
atgcctttgctcgattctccggtcgccagtccggtcgccggcgatgacgtgtttgtgaat
ttttcctatgtgaggcccagtactttccttcagaaacagagccttctgcagagctag

DBGET integrated database retrieval system