KEGG   Phalaenopsis equestris: 110031476Help
Entry
110031476         CDS       T05601                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
peq  Phalaenopsis equestris
Pathway
peq00562  Inositol phosphate metabolism
peq01100  Metabolic pathways
peq04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110031476
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    110031476
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:peq01009]
    110031476
Enzymes [BR:peq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110031476
    3.1.3.48  protein-tyrosine-phosphatase
     110031476
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     110031476
Protein phosphatases and associated proteins [BR:peq01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    110031476
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase3 Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 110031476
NCBI-ProteinID: XP_020590344
LinkDB All DBs
Position
Unknown
AA seq 603 aa AA seqDB search
MEASQSDSSPLRPIPNDNQHPSSGQDTYVQQSPSLLSSSGITSWAKNLKLPQAAGQEDSQ
TGNSGKSTFARFTSGLGLRFSPKSPPKDDNFDGSSTSTQQGALGSFTKGFVDTSKNAVKA
VQVKARHIVSQNKRRYQEGGFDLDLTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEE
VIRFFETHHKGKYKVYNLCSERLYDASLLEGKVACFPFDDHNCPPLELVTLFCQSAYNWL
KEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIEYYNQKRCIDGKGLVLPSQI
RYVKYFERILTYFNGENQPGRRCMLRGFRLHRCPYWIRPSITVSNHNGILFSTKKHPRTK
DLLPEDFWFSAPKKGIMVFALPGESGLTEVAGDFKINFHDRQGDFYWYDIAMLANYFILF
QKRKLPSPGFQVEIVLADHNGSVSPRPSRPAPNNETDQAPTAIIAPAEESKISHTTKTNI
ETRNKDDVFSDSEGDDGGSTKGKRSPASNNSATVHVVATEGSETEPPPKSGLPNISHRID
QISLKDKDATIPAPQAVQEQRTEETKSSAFQASELESTSTSEFKAIAADASVFSFGDEDY
ESE
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggaggcatcgcagtctgattcttctcctttacgtcccattccaaatgacaaccaacat
ccttcatctggacaagacacatatgtacaacaatcaccatcgcttctgtcttcctctgga
ataacctcctgggccaaaaacttgaagctaccacaggcagcaggccaagaggactctcaa
acaggaaattcaggaaagtcaacatttgctcgttttactagtggattgggactgcgtttt
tctcctaaatcacctccaaaagatgataatttcgatggctcttcaacctctactcaacag
ggcgctttaggctcttttacgaaaggttttgttgacacatcaaaaaatgcagtcaaagcg
gtacaggtgaaggcccgtcacattgtctctcaaaacaaaaggagatatcaggaaggtgga
tttgatttggatttgacttatatcacagaaaatataattgctatgggtttccctgcgggt
gatatgagttcagggttttttggctatgttgagggattttaccgtaaccatatggaggaa
gtgataagattttttgaaactcatcacaaggggaagtacaaagtatacaatctttgttca
gagaggctctatgacgcatcactacttgagggcaaggttgcttgtttcccatttgatgat
cataattgccctccacttgaacttgtgacattattttgtcaaagtgcctataactggttg
aaggaagacattgaaaacgttgttgttgtgcactgcaaagctggtatggcaaggacaggc
ttgatgatatctagccttcttttatatctgaagttcttcccaactgctgaggagtcaatc
gagtattacaaccagaaaagatgcatagatgggaagggtcttgttctcccaagtcagatt
agatatgtcaaatattttgagcgcatattaacatatttcaatggagaaaatcaaccaggt
cgtagatgtatgctaagggggtttcggttacatagatgcccttattggataagaccttca
attactgtctcgaatcacaatggtattctcttttctacaaaaaagcatcccaggactaaa
gacttattgcctgaggatttttggtttagtgcaccaaagaaaggaattatggtctttgca
ttgcctggtgaatctggacttacggaagtggctggggatttcaaaattaatttccatgat
cggcaaggagatttctattggtacgatattgctatgttagctaattatttcattttattt
caaaaaagaaaactcccttctcctggattccaagtggagattgttcttgcagaccataac
ggttccgtatcccctcgtccttctcgtccagctcccaacaatgaaactgatcaggcccca
acggcaataatcgcccccgccgaagaaagcaaaatctcacatactacgaaaacaaacatc
gaaactcgaaacaaggatgatgtcttctccgatagtgaaggcgatgacggcggttccacg
aaaggcaaacggtctcccgcctccaacaactccgcaaccgtgcatgtcgttgccaccgaa
ggctctgaaaccgaaccacctccaaaaagtggattaccaaacataagccatcgaatcgat
caaatctccctcaaagacaaggatgctacaatccctgctcctcaagcggttcaagagcaa
agaactgaggagaccaagtcctcggcatttcaagcatctgaattggaatctacgagcaca
agcgagttcaaggccatcgctgcagatgcctccgtcttctctttcggcgacgaagactat
gaaagcgagtag

DBGET integrated database retrieval system