KEGG   Phalaenopsis equestris: 110039169Help
Entry
110039169         CDS       T05601                                 

Definition
(RefSeq) probable glutathione S-transferase parA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
peq  Phalaenopsis equestris
Pathway
peq00480  Glutathione metabolism
peq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110039169
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:peq02000]
    110039169
Enzymes [BR:peq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110039169
Transporters [BR:peq02000]
 Other Transporters
  Pores ion channels [TC:1]
   110039169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_C GST_N_2 GST_C_6 GST_C_5 GST_C_3
Motif
Other DBs
NCBI-GeneID: 110039169
NCBI-ProteinID: XP_020599795
LinkDB All DBs
Position
Unknown
AA seq 221 aa AA seqDB search
MAEEKGVKLLDLWSSPFGQRCRITLAEKGVDYEYLEQNLSNKSELLLKSNPVYKKVPVLL
HDGKPVCESLIIVQYIDEVWQGKSSILPSDPYGRAQARFWADYVDKKFFECGTRLWKQKG
EALQEAKGEFIQILKTLEAELGDKKYFGGDAFGLVDIALVPFTSWFYSYETLAGFSVEQE
SSNLVAWAKRCLERESVAKTLYEPKKIYEFVGYLRKKYGME
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggagaagggagtgaagctgctggatctctggtccagccctttcgggcagcga
tgcaggataacgttggcggagaagggggtagattatgagtacctggaacagaacctgtcg
aacaagagcgagttgcttctgaaatcgaacccggtgtacaagaaggtccctgttctttta
catgatgggaagcctgtgtgtgaatcgcttataattgttcagtatatcgatgaggtatgg
cagggcaagtcgtctatcttgccttctgatccgtatggaagggcgcaagctcggttctgg
gctgattacgtcgataagaagttcttcgaatgtggcaccaggctgtggaaacagaaaggc
gaggccttgcaggaagcgaagggtgaattcatccagatcttgaagactctggaagccgag
ctcggtgacaagaagtatttcggcggcgatgccttcgggctggtcgacattgctctggtt
cccttcacaagttggttctacagctacgaaactctcgccggattcagcgtagagcaggag
agttcaaatctggtggcgtgggcgaagcgctgcttggagcgagagagcgtggcaaagact
ctgtatgagccgaagaaaatctatgagtttgtgggatatcttaggaagaagtatggcatg
gagtaa

DBGET integrated database retrieval system