KEGG   Candidatus Sodalis pierantonius: SOPEG_2933Help
Entry
SOPEG_2933        CDS       T03006                                 

Gene name
emrA
Definition
(GenBank) Membrane fusion component of tripartite multidrug resistance system
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
pes  Candidatus Sodalis pierantonius
Brite
KEGG Orthology (KO) [BR:pes00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pes02000]
    SOPEG_2933 (emrA)
Transporters [BR:pes02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   SOPEG_2933 (emrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 HlyD Biotin_lipoyl OEP Orf78 Spc7 LXG PrgH PTS_EIIA_1 Csm1_N
Motif
Other DBs
NCBI-ProteinID: AHF74453
UniProt: W0HQS5
LinkDB All DBs
Position
complement(3147010..3148245)
Genome map
AA seq 411 aa AA seqDB search
MAESQSTPQQNAANTRPDNAGAAPARNKGKRKMMLLLLLAVVVICLVAFGLYYWLHGRFY
ESTDDAYVTGNLVQITSQVAGTVTTIAADDGDYVKQGQLLVRLDPSDTIVAQESAEANLA
RVVRQVRGMYSNVDNYKAMVAARKVELQRARTDYQRRANLARDGAISQEELSHARDALTS
AETSLTSTQQQLNTTFALVDDTTIASHPDVKDAAASLRSAYLNHVRSTLVAPVSGFVAKR
SVQVGSRVQPGAALMAVVPLDDVWIDANFKETQLLSMRIGQPVDINADLYGGDITYHGKV
ESLGVGTGSAFSLLPAQNASGNWIKIVQRLSVRIRLDPDNLDHHPLRVGLSTNVTVDMHN
QDGPVLAPRPLDKPRYNTDVYEHQLREADSLVTRIIHQNGVQARDADQGQQ
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatcgcaatctactccgcaacaaaatgcggctaacaccaggcctgataacgcc
ggtgctgcgccggcgcgcaataaaggcaagcgcaaaatgatgctgcttctcctgctggcg
gtcgtcgtcatctgtctggtcgcttttggcctgtattactggctgcacggccggttctac
gaaagtaccgacgacgcttatgtgaccggcaacctggtgcaaattacgtcgcaggtggcg
ggtaccgtgaccactatcgcggctgatgacggcgactacgtcaaacaagggcaacttctg
gtgcgtctggatcccagcgataccatcgtggcgcaggaaagcgccgaggccaatctggcc
cgtgtggtgcgccaggtgcgcgggatgtacagcaacgtggataattacaaagcgatggtc
gccgcgcgtaaagtggaactccagcgcgcgcgtaccgattatcagcgccgcgccaatctg
gcgcgcgacggcgccatctcgcaggaggagttgtcccatgcccgtgatgccctgacctcg
gcggaaacctcgctgacgtcgacgcagcaacagttgaacacgaccttcgcgctggtggac
gataccactatcgcctcccatccggacgtcaaagatgccgccgcctcgctgcgcagcgcc
tatctcaaccatgtccgcagtacgctggtggcaccggtcagcggttttgtcgccaaacgc
tcggtacaggtgggcagccgggttcagccgggcgccgccttaatggccgtggtgccgctg
gatgatgtgtggatcgacgccaacttcaaggaaacgcagctgctgtcgatgcgtattggt
cagccggtggacattaacgccgatctgtacggcggcgacattacttaccacggcaaagtg
gaaagtttgggcgtcggtaccggaagcgctttctcgctgctgccggcgcagaacgccagc
ggcaactggatcaaaatcgtgcagcgcctgtcggtacgtatccgcttggatccggacaat
ctggatcaccatccgctgcgggtcggtttgtccaccaacgtgacggtggatatgcacaac
caggacggaccggtgctggcgccgcggcctttggataaaccccgatacaataccgacgtc
tacgaacatcagctgcgtgaagcggatagcctggtgacgcgcatcattcatcaaaatggc
gtccaggcacgcgatgccgaccaaggtcaacagtga

DBGET integrated database retrieval system