KEGG   Petrimonas sp. IBARAKI: PEIBARAKI_5405Help
Entry
PEIBARAKI_5405    CDS       T05132                                 

Definition
(GenBank) Cobalamin synthase
  KO
K02233  adenosylcobinamide-GDP ribazoletransferase [EC:2.7.8.26]
Organism
pet  Petrimonas sp. IBARAKI
Pathway
pet00860  Porphyrin and chlorophyll metabolism
pet01100  Metabolic pathways
Module
pet_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:pet00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PEIBARAKI_5405
Enzymes [BR:pet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.26  adenosylcobinamide-GDP ribazoletransferase
     PEIBARAKI_5405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobS DUF4064 DUF2530
Motif
Other DBs
NCBI-ProteinID: BBD45412
UniProt: A0A3G9E5W7
LinkDB All DBs
Position
complement(1694109..1694864)
Genome map
AA seq 251 aa AA seqDB search
MKQQLNLFFHALQFYSRIPAGKIDYSEENLAQSIRYFPLVGSVVGIVGTSVFMLFMLVFS
QGVSVTAALISMIAVTGALHEDGVSDFFDGFGGAYTRERILEIMKDSHVGAYGVISLVLL
LLAKFSLLTSITPEKVPLVLIAAHTSSRFVAVALMKSSSYARTENSKSAHSRLSLSRTTV
VTAFVFGVLPLVFIPPLVSAVAAIVYAIILFALKHYVEKKIGGFTGDVLGTLQQFCEIAF
YLVYTALISLI
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcaactcaacctcttctttcacgcgctgcagttctacagccgcatcccggca
ggaaaaatcgactacagtgaagaaaacctggcgcaatcgatccgttattttccgctggta
ggcagtgtggttgggattgtcggcacatctgtatttatgctgttcatgctcgttttttca
cagggagtctcggtcacggcagcccttatttctatgatagccgtaaccggcgccctgcat
gaagatggtgtttccgacttttttgacggatttggcggagcctacacccgggaacgtata
ctggaaattatgaaggatagccacgtgggcgcctacggcgttatttcgctcgtgctgcta
ctcctggccaagttttcgttgctgacatccatcacccctgaaaaagttccgctggtgctg
atcgccgcgcacacttccagccgttttgtggcggtggccctgatgaaatcgtctagctat
gcccgcacagaaaacagcaaatcagcgcattcccgcctgtctttatcgcgaacgacagtg
gttacggcgttcgttttcggggtgctgccgctggtctttattcctccgcttgtaagtgcc
gttgcagccattgtctacgcaattatcctcttcgcgctgaaacactacgtggagaagaaa
atcggcggattcacgggagatgttctggggacactgcaacaattttgtgaaattgcattc
taccttgtttacacagcactgatttccttaatttaa

DBGET integrated database retrieval system