KEGG   Petrimonas sp. IBARAKI: PEIBARAKI_6763Help
Entry
PEIBARAKI_6763    CDS       T05132                                 

Definition
(GenBank) naphthoate synthase
  KO
K01661  naphthoate synthase [EC:4.1.3.36]
Organism
pet  Petrimonas sp. IBARAKI
Pathway
pet00130  Ubiquinone and other terpenoid-quinone biosynthesis
pet01100  Metabolic pathways
pet01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pet00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    PEIBARAKI_6763
Enzymes [BR:pet01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.36  1,4-dihydroxy-2-naphthoyl-CoA synthase
     PEIBARAKI_6763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 SDH_sah
Motif
Other DBs
NCBI-ProteinID: BBD46770
UniProt: A0A3G9ER24
LinkDB All DBs
Position
3402548..3403369
Genome map
AA seq 273 aa AA seqDB search
MIRREWITIKEYEDILFDLYNGIARITINRPRYRNAFTPTTTGEMSDALRLCREMEEVSV
VVLTGVGDKAFCSGGDQNVKGKGGYIGKDGVPRLNVLDVQKQIRSIPKPVIAMVNGYAIG
GGHVLHVVCDLTIASENAIFGQTGPRVGSFDAGFGSSYLARIVGQKKAREIWFLCRQYNA
QEALDMGLVNKIVPFDRLEDEVVEWAETMMQHSPLALRMIKAGLNAELDGQAGIQELAGD
ATMLYYLTEEAQEGKQAFLEKRKPDFKKFPKLP
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgatacggagagaatggattaccatcaaagaatacgaagatatcctctttgatctttac
aacggaattgcacgaatcaccatcaaccggccgcgataccgcaacgccttcaccccaacc
acgaccggagagatgagcgacgccctgcgcctttgtcgtgagatggaagaggtaagtgta
gtggtgctcaccggtgtgggtgacaaagccttctgctcgggtggcgaccagaacgtaaag
ggtaagggaggctatatcggcaaggacggtgttccacgcctcaacgtgctggatgtacag
aaacagattcgctccattcccaagccggtgatcgccatggtaaacggctacgccatcggc
ggaggacatgtactgcacgtagtgtgcgacctgactatcgcttccgagaacgccatcttc
ggacagacgggcccccgcgtgggtagcttcgacgccggtttcggatcttcatacctggcc
cgcatcgtgggacagaaaaaagcacgggagatatggtttctctgccgccagtacaacgca
caggaggcgctcgatatgggactggtgaacaagatagtgcctttcgaccgcctcgaggat
gaggtggtggaatgggccgagacaatgatgcaacacagcccccttgcgctgcgcatgatc
aaggccgggctcaacgccgaactggacggacaggcaggcatccaggagctggcgggagac
gccaccatgctctactacctgaccgaggaggcacaggaagggaaacaagcgttcctggaa
aaacggaaacccgatttcaaaaagtttcccaaactaccctga

DBGET integrated database retrieval system