KEGG   Populus euphratica (Euphrates poplar): 105139099Help
Entry
105139099         CDS       T05872                                 

Definition
(RefSeq) probable 6-phosphogluconolactonase 5, chloroplastic
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
peu  Populus euphratica (Euphrates poplar)
Pathway
peu00030  Pentose phosphate pathway
peu01100  Metabolic pathways
peu01110  Biosynthesis of secondary metabolites
peu01200  Carbon metabolism
Module
peu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
peu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:peu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    105139099
Enzymes [BR:peu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     105139099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucosamine_iso
Motif
Other DBs
NCBI-GeneID: 105139099
NCBI-ProteinID: XP_011043721
LinkDB All DBs
Position
Unknown
AA seq 321 aa AA seqDB search
MATAASSLTPSTSLPKPSRPFSISISQLPQVSLNFKKLNCSISCALKISRRTATSTATKA
SSMASSGITTVDQNNKKAVEVFDTEEELAVSLAKYTADLSDKFAKERGSFTVVVSGGSLI
KSLRKLVQAPYVDSIDWSKWHVFWVDERVVPKDHPDSNYKLAFDGFLSKVPIPPGNVHAI
NDALSAEGAADDYETCLKHLVHTGVIEKSSVSGFPKFDLMLVGMGPDGHVASLFPGHPLL
KENQKWVTHITDSPKPPPGRITFTFPVINSSSYIALVVCGAGKASQTALGKSQNSDVFPV
QMVSPEGELKWFLDRDAASKL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggctactgctgcttcatctctcactccctccacttctctgcctaaaccgagcagaccc
ttttccatttctataagccaactacctcaggtatcgttgaatttcaagaaactcaattgc
tcgatcagttgtgctttaaagatatctagaagaacagcaacatcaacagcaacaaaggca
tcgtccatggcttcttctgggatcaccaccgttgaccagaacaacaagaaggcagtggaa
gtgtttgatacagaggaggaactggctgtgtctcttgcaaaatacacagctgatttatct
gataaatttgccaaagaaagagggtctttcactgttgttgtgtctggtggttctctcatc
aagtccctcaggaaattagtgcaggcaccttatgtggattcaatagattggtcgaaatgg
catgtattttgggtggatgagagagttgttcctaaagatcatccagacagtaactacaaa
cttgcttttgatggttttctttcaaaggtaccaattccccctggtaatgtccatgccatc
aacgatgcactgtcagctgagggtgctgccgatgattatgaaacttgtctcaaacatttg
gttcatactggtgtgatagagaaatcttcagtgagtgggttcccaaagttcgatctcatg
cttgtgggcatgggcccagatggacatgtagcctctctgttccctggccacccactcctc
aaggaaaatcagaaatgggttactcacatcacagattccccaaaaccacctcctgggaga
attacatttaccttccctgtcatcaattcatcttcatacatcgctcttgtggtatgcggt
gctggtaaagctagccagacagcattgggaaagagtcaaaactctgacgtgtttcctgtt
caaatggtttcacctgaaggggagttgaagtggtttttggacagagatgcagcttcaaag
ttgtag

DBGET integrated database retrieval system