KEGG   Pantoea eucalypti: EE896_04130
Entry
EE896_04130       CDS       T06282                                 

Definition
(GenBank) DUF3412 domain-containing protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
pey  Pantoea eucalypti
Pathway
pey00230  Purine metabolism
pey00240  Pyrimidine metabolism
pey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pey00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EE896_04130
   00240 Pyrimidine metabolism
    EE896_04130
Enzymes [BR:pey01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     EE896_04130
    3.2.2.-  
     EE896_04130
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: QGF26084
UniProt: A0A5Q2FKF9
LinkDB
Position
complement(868641..870005)
AA seq 454 aa
MITHISPLGSMDLLSQLEVDMLKRTASSDLYQLFRNCSLAVLNSGSQTDSSHELLSRFEN
FDINVLRRERGVKLELINPPEEAFVDGRIIRSLQANLFAVLRDILFVSGQLNMPGRFTAA
EENDSATITNTVFSILRNARALHIGEYPNTVVCWGGHSINAVEYQYCRNVGTQLGLRELN
ICTGCGPGVMEAPMKGAAVGHAQQRYRDSRFIGLTEPSIIAAEPPNPLVNELIIMPDIEK
RLEAFVRIAHGIIIFPGGVGTAEELLYLLGILMNPQNNDQVLPLILTGPEESADYFRVLD
DFIVNTLGEQARKHYQIIIDDAAEVARLMKKAMPQVKENRRETGDAYSFNWSIRIEPDLQ
VPFLPTHENMANLNLYTNQPPEKLAADLRRAFSGIVAGNVKEMGIREIREKGRFKLHGDP
DIMHRMDELLQGFVAQQRMKLPGTAYIPCYEIIK
NT seq 1365 nt   +upstreamnt  +downstreamnt
ttgattacccatatcagtccacttggctcaatggatctgctctcgcaactggaagtcgat
atgcttaagcgcacagccagcagcgacctctaccagctgtttcgcaattgctctctggca
gtactcaactccggcagccagactgacagcagccacgaactgctctcccgctttgagaat
tttgacatcaacgtgctgcgccgtgagcgcggcgtcaaactggaactgatcaatccaccg
gaagaggcgttcgttgatggccgcatcatccgttccctgcaggcaaatctgtttgcggtg
ctgcgtgacatcctgtttgtcagcggccagctcaacatgccgggccgtttcacggcagcc
gaagagaacgattccgccacgatcaccaacaccgtgttttccattttgcgtaatgcacgg
gcactgcacattggcgagtatcccaacaccgtagtgtgctggggtggacactcaatcaac
gccgttgagtaccagtattgccgcaatgttggtacgcagttgggtctgcgcgagctgaat
atctgtaccggctgcgggccgggcgtgatggaagcaccaatgaaaggggccgccgttggc
cacgcccagcagcgctatcgtgacagccgctttatcggcctgacagaaccctcgatcatt
gcggctgaaccgccgaatccgctggtgaatgagctgatcatcatgccagacatcgaaaaa
cgtctggaagcgtttgtgcgtatcgcccatggcatcattattttcccgggcggggtcggc
acggcagaagagctgctctatctgctgggcattctgatgaatccgcagaacaacgaccag
gtactgccgctgatcctgaccggaccagaagagagcgccgattatttccgtgtgctggat
gatttcatcgtcaacacgctgggtgaacaggcgcgtaagcattatcagattattatcgat
gatgcggcagaagtggcgcgtctgatgaagaaagcgatgccgcaggttaaagagaatcgt
cgcgaaaccggcgatgcttacagctttaactggtcgattcgcattgaacccgatctgcag
gtgccgttcctgcccacccatgaaaatatggctaacctcaatctctacacgaatcagcct
cctgagaagctggccgccgacctgcgccgcgccttctcaggcatcgtcgcgggtaacgtt
aaagagatgggcatccgcgaaatccgtgagaagggacgctttaaactgcatggcgacccc
gacatcatgcaccgcatggatgaactgctgcagggattcgttgcccagcagcgcatgaag
ctgccaggcactgcttacatcccctgctacgaaattatcaaataa

DBGET integrated database retrieval system