KEGG   Pantoea eucalypti: EE896_06610Help
Entry
EE896_06610       CDS       T06282                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pey  Pantoea eucalypti
Brite
KEGG Orthology (KO) [BR:pey00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EE896_06610 (ahpF)
Enzymes [BR:pey01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EE896_06610 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 Glutaredoxin Thi4 NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: QGF26538
LinkDB All DBs
Position
1424348..1425913
Genome map
AA seq 521 aa AA seqDB search
MLDTNLKTQLKAYLEKLTRPVELIATLDEGAKSTEIRELLVDIAGLSDKVSFREENDRQV
RKPSFLITNPGSNSGPRFAGSPLGHEFTSLVLALLQTGGHPSKEAQSLLDQIAALDSDFH
FETYYSLSCHNCPDVVQALNLMAVINPRISHTAIDGGLFQNEIQERNVMGVPAVYLNGKE
FGQGRMSLAEIVSKVDTNADKRAAEELNKRDAYEVLIIGSGPAGAAAAIYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGAKLAGSLRAHVDDYNVDVIESQSAIKLIPAAKEG
GLHAIETASGAVLKSRSIILATGARWRNMGVPGEEEYRTKGVTYCPHCDGPLFKGKRTAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAGEMRADQVLQDKLRSLKNVDVILNAQTTEVKGD
GTKVTGLHYLDRTTQTTHELPLSGIFVQIGLLPNTPWLEGAVERNKMGEIIIDGKCETSL
KGVFAAGDCTTVPYKQIIIASGEGAKASLSAFDYLIRTKSA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatttgaaaacccagctcaaggcctaccttgagaaattaaccagacct
gttgagttgattgccaccctggatgagggtgcaaaatcaaccgagatccgtgaactgttg
gttgatatcgccggcttgtctgacaaagtcagcttccgcgaagagaacgatcgtcaggtg
cgtaagccctcatttctgatcaccaacccaggttcgaacagcggcccgcgttttgccggt
tcacctctgggtcacgaatttacctcactggtgctggcactgttacagaccggtgggcat
ccgtctaaagaagcacagagcctgctggaccagatcgccgcgctggacagcgacttccat
ttcgaaacctattattcactctcatgccataactgcccggacgtcgtccaggcgctgaac
ctgatggcggtgattaacccgcgcatcagccacactgctatcgacggtggcctgttccag
aacgagattcaggaacgcaacgtgatgggcgtgccagcggtttacctgaatggtaaagag
tttggtcagggccgcatgagcctggcggaaatcgtcagcaaagtagataccaacgcggat
aaacgtgcagcggaagagctgaacaagcgtgacgcctatgaagtcctgattatcggcagt
ggccctgcgggtgcagcggcagccatctactcagcgcgtaagggtatccgtactggcctg
atgggcgaacgttttggcggccaggtactggatacggtggatatcgaaaactatatctcc
gtaccgaaaaccgaaggcgcgaaactggcaggttcactacgcgcacacgtcgatgattac
aatgtggatgtcattgaaagccagagcgccatcaaactgattccggcggcgaaagagggc
ggactgcatgccatcgaaaccgcctccggcgcagtattgaagtctcgcagtatcattctg
gcaaccggcgcacgctggcgcaatatgggtgtgccgggtgaagaagagtatcgcaccaaa
ggcgtcacctactgcccacactgcgatggcccgctgtttaaaggcaagcgcacggcagtg
atcggcggcggtaactccggcgttgaagcagccattgacctggcgggtatcgttgaacat
gttacgctgctggagtttgccggtgagatgcgtgccgaccaggtattgcaggataagctg
cgtagcctgaagaacgttgatgtcattctgaacgcgcagaccaccgaagtgaaaggcgac
ggcactaaagtgaccggcctgcactatcttgaccgtacgacgcagaccacccatgagctg
ccgctctctggtatcttcgttcagatcggtctgctgccaaataccccgtggctggaaggc
gcggttgagcgcaataaaatgggtgagatcatcattgatggtaaatgcgaaaccagcctg
aaaggcgtgttcgcggcgggcgactgcaccaccgtgccgtacaagcagattattattgcc
agcggcgaaggcgcaaaagcttcactgagcgcttttgactatctgattcgcactaaatca
gcttaa

DBGET integrated database retrieval system