KEGG   Plasmodium falciparum 3D7: PF3D7_0306400Help
Entry
PF3D7_0306400     CDS       T00095                                 

Definition
(RefSeq) FAD-dependent glycerol-3-phosphate dehydrogenase, putative
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa00564  Glycerophospholipid metabolism
pfa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PF3D7_0306400
Enzymes [BR:pfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     PF3D7_0306400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 Reovirus_L2 Pet20 HI0933_like Menin
Motif
Other DBs
NCBI-GeneID: 814382
NCBI-ProteinID: XP_001351140
PlasmoDB: PFC0275w
GeneDB: PFC0275w
UniProt: O97245
LinkDB All DBs
Position
3:298517..300478
Genome map
AA seq 653 aa AA seqDB search
MIKKVAICSGTLGILSYGGFYFLKINFQKNMIDKDVTYKYSPCIKRNEMIKKLQENQYDL
LIIGGGATGAGLALDAATRGLKCALVEKNDFSSGTSSKSTKLLHGGIRYLENAVNNLDFT
ELYFVWEALAERAHTMKIAPYLSRPVSILMPIYKYWQVPYFSYNIKIYDLLADLVCYFDK
GVPNSLYIRKSNTIDNFPLLRKDKLKGSLIYFDGQHDDSRMNLNLILTSAIDNYVPGQIG
ATVCNHMEVKNFIKDENNKLVGVRAIDKINDKEIEIFSKVIINATGPYGDIIRKLADENR
KPMIQVSVGCHFILPKWYSTKNNGMIIPKTSDDRVLFLLPWENNTLVGTTDEKRIMQDDP
KIQEKDIEFLTNELSKYIHVSAEEIKNDITAAWCGFRPLISTNNNKKSKFSSNKKKNNNN
NINSNSSSNSNNFDDEQNNNNNNIGTHEISRSHEIIEDDNGLISILGGKWTIYRKMAQDT
LDYILRKYPNELKTKYNCRTKFLKLIGCHDKYGIFNEDDLTFGCSKLSKTLVNKYPQIDF
QTANHLVSNYGYLSENVCELAKELNMFNKIDPTKPYIEAEIIYATRYEFANTISDIIGRR
FRLGFIDSQVSNKVIDKIAQLLKNELTWNTEQVNKNVKEAKDYINSLSLKDTI
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagttgctatttgtagtgggaccttgggtattttatcctatggagggttt
tattttttaaaaataaattttcaaaagaatatgatagataaagatgtgacatataaatat
agtccttgtataaaaagaaacgaaatgattaagaagctacaagaaaatcaatatgattta
ttaataataggaggaggtgctacaggtgctggtttggccttagatgcagccacaagagga
ttaaaatgtgcgctagtagaaaagaatgatttttcaagtggtacatcttctaagtctacc
aaattattacatggtggtataagatatttagaaaatgcagtaaataatttagattttaca
gaattatattttgtatgggaagcattagcagaaagagcgcacacaatgaaaatagcacca
tatttatcaagaccagtatctattttaatgcctatatataaatattggcaagtaccttat
ttttcttataatattaagatatatgatttattagctgatctggtttgttattttgataaa
ggtgtacctaattctttatatattagaaaatcgaatactatcgataatttcccattatta
agaaaagataaattgaaaggatctttaatttattttgatgggcaacacgatgatagtaga
atgaatttaaatttaatattgactagtgctattgataattatgtacctggacaaatagga
gctactgtatgtaatcatatggaagtgaaaaattttataaaagatgaaaataataaactt
gttggtgtacgtgccatagataaaattaatgataaagaaattgaaatattttcgaaagtt
attattaatgctactggtccatatggtgatatcatacgtaaactagctgatgaaaataga
aaacccatgatacaagtttctgttggatgccatttcatattacctaaatggtactctaca
aaaaataatggaatgataataccgaaaactagtgatgatagggtacttttcttactaccc
tgggaaaataatactttagtaggtactactgatgaaaaaagaataatgcaagatgatccg
aaaatacaagaaaaggatatcgaattcttaacaaatgaactatctaaatatattcatgta
agtgcagaagaaattaaaaatgatataaccgctgcatggtgtggttttagacctctaatt
tcaacaaataataataaaaaaagcaaattttcttcaaacaaaaagaaaaataataacaac
aatattaatagtaatagtagtagtaatagtaacaattttgatgatgaacaaaataataat
aataataatataggtacacatgaaatatcaagaagtcatgaaattatagaagatgataat
ggtcttatcagtatattaggtggcaaatggactatatatagaaaaatggcacaagacacc
ttagattatattttacgtaaatatccaaatgaactaaaaacaaaatataattgtcgaact
aagtttttaaaacttataggctgtcatgataaatatggtatctttaatgaagatgattta
acttttggttgtagtaaattaagtaaaacacttgttaataaatatccacaaatagatttt
caaacagcaaatcatttagtttctaattatggttatttatcggaaaatgtatgtgaacta
gccaaagaattaaatatgttcaataaaatagatcctaccaaaccatatatagaagctgaa
attatttatgcaaccagatatgaatttgctaataccatatcagatattattggaagaaga
ttcagattaggttttattgattcgcaagtatccaataaagttattgataaaatagctcaa
ctcttgaaaaatgaattaacatggaatactgaacaagttaataaaaatgtaaaggaagct
aaagattacataaattctttatccctaaaagatacaatataa

DBGET integrated database retrieval system