KEGG   Plasmodium falciparum 3D7: PF3D7_1141600Help
Entry
PF3D7_1141600     CDS       T00095                                 

Definition
(RefSeq) dolichol-phosphate mannosyltransferase
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa00510  N-Glycan biosynthesis
pfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    PF3D7_1141600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pfa01003]
    PF3D7_1141600
Enzymes [BR:pfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     PF3D7_1141600
Glycosyltransferases [BR:pfa01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   PF3D7_1141600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_transf_21 Glyco_tranf_2_2 Glyco_transf_7N Glyco_tranf_2_4 Arc_PepC
Motif
Other DBs
NCBI-GeneID: 810973
NCBI-ProteinID: XP_001348097
PlasmoDB: PF11_0427
GeneDB: PF11_0427
UniProt: Q8IHU9
LinkDB All DBs
Position
11:complement(1668302..1669081)
Genome map
AA seq 259 aa AA seqDB search
MVIRFFLFVITLLGLCINMVCCNFKYSIILPTYNEKENLPYLIYMIIDELNKHEIKFEII
VIDDNSQDGTADVYKKLQNIFKDEELLLIQRKGKLGLGSAYMEGLKNVTGDFVIIMDADL
SHHPKYIYNFIKKQREKNCDIVTGTRYKNQGGISGWSFNRIIISRVANFLAQFLLFINLS
DLTGSFRLYKTNVLKELMQSINNTGYVFQMEVLVRAYKMGKSIEEVGYVFVDRLFGKSKL
ETTDILQYLSGLFKLFWSI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttattcgatttttcctgtttgtcattacactcttaggcttatgcataaatatggtg
tgttgtaattttaaatattcgattatattacctacttacaatgaaaaagaaaacttacca
tatcttatttatatgataattgatgaattaaataaacatgaaattaaatttgaaataatt
gtaatagatgataatagtcaagatggtactgcagatgtgtacaaaaagttacaaaacatt
tttaaggatgaagaattattattaatacaaagaaaaggaaaattagggttaggttctgca
tatatggaaggtttaaaaaatgtaacaggagattttgttataataatggatgctgattta
tcacatcatcctaaatatatttataactttattaaaaaacaaagagaaaaaaattgtgac
attgttacaggcacaagatataagaaccaaggtggaatatcaggatggtcatttaataga
attataataagtagagtagcaaattttttagctcaatttctattattcattaatctatca
gatttaaccgggtcttttagattatataaaactaatgtactgaaggaacttatgcaatct
attaataatacaggttatgtttttcaaatggaagttcttgtaagagcatataaaatggga
aaatctatagaagaagttggttacgtttttgttgatagattatttggaaaatcaaaactg
gaaactacagatattttacaatacttatcaggtcttttcaagttattctggtcaatataa

DBGET integrated database retrieval system