KEGG   Plasmodium falciparum 3D7: PF3D7_1323000Help
Entry
PF3D7_1323000     CDS       T00095                                 

Definition
(RefSeq) beta-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa00061  Fatty acid biosynthesis
pfa00780  Biotin metabolism
pfa01100  Metabolic pathways
pfa01212  Fatty acid metabolism
Module
pfa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PF3D7_1323000
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PF3D7_1323000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pfa01004]
    PF3D7_1323000
Enzymes [BR:pfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PF3D7_1323000
Lipid biosynthesis proteins [BR:pfa01004]
 Fatty acid synthase
  Component type
   PF3D7_1323000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA DUF1390 MaoC_dehydratas
Motif
Other DBs
NCBI-GeneID: 814099
NCBI-ProteinID: XP_001349970
PlasmoDB: PF13_0128
GeneDB: PF13_0128
UniProt: Q8I6T4
LinkDB All DBs
Structure
PDB: 

Position
13:complement(join(963661..963797,964135..964690))
Genome map
AA seq 230 aa AA seqDB search
MRFLIIHIAVIVLPFVLMIDVKRENSFFLRHSPKRLYKKADYNNMYDKIIKKQQNRIYDV
SSQINQDNINGQNISFNLTFPNYDTSIDIEDIKKILPHRYPFLLVDKVIYMQPNKTIIGL
KQVSTNEPFFNGHFPQKQIMPGVLQIEALAQLAGILCLKSDDSQKNNLFLFAGVDGVRWK
KPVLPGDTLTMQANLISFKSSLGIAKLSGVGYVNGKVVINISEMTFALSK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttcttatcatccatattgctgttatcgttttacctttcgtgttgatgatagat
gtaaaaagggaaaattctttttttctacgacactcaccaaaaagattatacaaaaaagct
gattataataatatgtatgataaaataattaagaaacaacaaaatagaatatatgatgta
tcttctcaaataaaccaagacaatattaacggacaaaatatttcattcaatttaaccttt
cctaattatgatacaagtattgatatagaagatattaagaaaattcttccacatagatat
cctttccttttagttgataaagtaatatatatgcagcctaataaaacaattattggatta
aagcaagtatcaactaatgaacctttttttaatggacattttccacaaaaacaaattatg
cctggtgttcttcaaattgaggctttggcgcagttagcgggtattttatgtctcaaaagt
gatgatagtcagaagaataatttatttttatttgctggagtggatggagtaagatggaaa
aaacctgtacttccaggtgatacattaacaatgcaggcgaatttaatatcatttaaatca
tccctaggtattgcaaaattgagtggagttggttatgtaaatggtaaagtagtaataaat
atatcagaaatgacgtttgccttatcgaaataa

DBGET integrated database retrieval system