KEGG   Phascolarctobacterium faecium: PFJ30894_01702Help
Entry
PFJ30894_01702    CDS       T05784                                 

Definition
(GenBank) Peptidase M16C associated
  KO
K06972  presequence protease [EC:3.4.24.-]
Organism
pfac  Phascolarctobacterium faecium
Brite
KEGG Orthology (KO) [BR:pfac00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pfac01002]
    PFJ30894_01702
Enzymes [BR:pfac01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     PFJ30894_01702
Peptidases and inhibitors [BR:pfac01002]
 Metallo peptidases
  Family M16: pitrilysin family
   PFJ30894_01702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: M16C_assoc Peptidase_M16_C Peptidase_M16 Troponin
Motif
Other DBs
NCBI-ProteinID: BBG64063
UniProt: A0A3G9H8C0
LinkDB All DBs
Position
complement(1714698..1717622)
Genome map
AA seq 974 aa AA seqDB search
MKLDVNKQYSGFVIRQAAYIDEIQSEAYVMEHTYSGARLLYLGNNDDNKVFSISFRTPPY
DDTGVAHILEHSVLCGSRKYRLKEPFVELVKGSMNTFLNAMTYPDKTMYPVASRNAKDFQ
NLMDVYLDAVFYPLIYENPYTLRQEGWHYNIEEPTDALSYNGVVYNEMKGVFSSADALLD
YEAMKALFPDTPYSFESGGHPDAIPELTQEAFEHFHTTYYSPENSFIYLYGDMDIETTLQ
YLNDEYLSGFKRTSAVNSEIPLQNAFARTQEVLGTYPVGADEATEDKTYHELHIVTGDAR
DVKTSMALRVLESVLLEGNSAPLRLALLQSGVAKDISGSYAGSYRQPIFSIKAAGSKPEQ
RDKFISIIYHTLQQLTINGIDKELLEAHLNYLEFKLREADFGAYPKGLIYGISVMDSWLY
DGDPLAGLRYTEALQQLREGIKTRYYEQLIENYLLDNTHKVIVTLDPEQGKEEREQEVLA
EKMAALKASMDTETIAQNIELCSELHKRQAAADTAEALETIPLLERSDIRREVEVTETVL
KQLGTNDILYVPAFTNKIAYLNWYFDLTGIDKDLLPYCYLLSDVLGKFNTDKYTYQELAT
ASNKYTGGVSFQMHAYSAADDANDYTIKFTVQAKALTANLDKLFDILQAVALGSKIDDAK
RLQEILDEVKTDWDSSFFSRGQTVACTRLASYFSTAARVNEQDQFSYYEFLKELSADFAG
RAEDTLAKLRQLLGIFFESSKYLLAYSCEESERMLVLEQALNFAALLPQSAVAGKTPQFL
EAPGENEGIMTPGKVQYVAAGGDFHKFGYQFHGAMKVLEIILRYEYLWTKIRVQGGAYGA
TARFDRNGTMFFASYRDPKLKESLQAYYDMPSWLEKLELSERELTKYIIGTISGLDTPLT
NSMRLEQAGVYHLKQVDTAMRQQMRSEIIDLTNADLQKLAPLIRDTLSEKYLCVVGSSQS
IEANKNIFTKTQHI
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagacgtaaataaacaatacagcggctttgtgatcaggcaggctgcttatatc
gacgagattcagtcagaagcatatgtgatggagcacacttacagcggtgccagactttta
tatttaggtaacaatgatgataataaggttttttcgatcagcttcaggacgccaccgtat
gatgatacaggtgtggcgcatattttagagcattcagtgttgtgcggttcgcgcaagtat
cgcttaaaagagccatttgtagaactggttaaaggttcaatgaatacttttctgaacgca
atgacttatcctgataagactatgtatccggttgccagccgcaacgccaaagattttcaa
aatctgatggatgtttatctggacgctgttttttatccgctgatttatgaaaatccctat
accctgcgccaagagggctggcattataatattgaggaaccgacggacgctttgagctat
aacggggtcgtctataatgaaatgaagggcgtattttcttctgctgatgctttgcttgac
tatgaggcaatgaaggcattgttccccgacacgccgtacagctttgaatccggcggccat
ccggatgctatcccagaattgactcaggaagctttcgagcatttccataccacttattac
agccctgaaaattcatttatttatctgtatggcgatatggatatcgaaacaacactgcag
tatctgaacgacgaatatttgagcggctttaaacgcaccagcgcagtgaactcggaaata
cctctgcagaatgcttttgccagaacgcaggaagttcttggcacttatccggttggagct
gacgaagctaccgaagataaaacttatcacgaactgcatatagttactggtgatgcacgt
gatgttaaaacctcgatggcattaagagtattggaaagtgttctgctggaaggcaattcg
gcgccgctgcgtctggcgttgctgcaatccggtgttgccaaagacattagcggctcttat
gccggaagctaccgccagccgatcttttcgattaaagccgccggttccaaaccggaacag
cgcgataaatttatcagtattatttatcacacgctgcagcagctgacgatcaacggcatc
gataaagagctgttagaggcacatctcaattatttggaatttaagctgcgggaagctgat
ttcggcgcttatcccaaaggcttgatttatggtatcagcgtgatggattcctggctgtat
gacggagatcctttagcaggtctgcgctatactgaggctttacagcagctgcgcgaaggt
atcaaaacacgttattatgagcagctgattgaaaattatctgctggataatacccataag
gttatagtgactctggatcctgagcaggggaaagaggaacgggagcaggaagtactggca
gaaaaaatggctgcgctcaaagcgtcgatggatactgaaactatcgcccaaaatatcgaa
ctgtgcagcgaactgcacaaacgccaggctgcagctgatactgccgaggcgctggaaacg
atcccgctgttggaacgcagcgatatcagacgtgaagtagaagttacagaaactgttttg
aaacagctgggaacaaacgatatcttatatgtaccggcttttaccaataaaatagcttat
ctgaactggtattttgatttgacaggtattgataaagatctgttgccttactgttatctg
ctcagtgatgtgcttggaaaatttaataccgacaagtatacctatcaggagctggccacg
gcctctaacaaatataccggcggtgtttctttccagatgcatgcttactcagctgccgac
gacgctaacgattatacgatcaagttcaccgttcaggctaaagcgctgacagctaatctg
gataaattgttcgacattctgcaggcagttgcgcttggcagtaaaatagacgacgccaaa
cggctgcaggaaattttagacgaagtaaaaacagattgggacagcagcttcttctctcgg
gggcagactgtagcctgtacccgtctggcttcatatttttcaacggcagcccgagtcaat
gaacaggatcaattcagctattacgaatttttaaaagagctgtcagccgactttgctggc
agggcagaggataccttagcaaaattaaggcagctgttgggtattttctttgaaagcagc
aaatatcttctggcttattcctgtgaagaaagcgaacggatgctggttttagagcaggct
ctgaattttgcagctttactgccgcagtcagctgttgccggtaaaacaccgcagttttta
gaggcgccgggagaaaatgaagggatcatgacacccggcaaggtacaatatgttgctgcc
ggcggtgattttcacaaatttggctatcagttccacggcgcaatgaaggtactggaaatt
atcctgcgttacgaatatctgtggactaaaatcagggtacagggcggcgcttacggtgcg
acggcgcgttttgaccgtaacgggaccatgttttttgcttcctaccgtgatccgaagctg
aaagaatcgctgcaggcatattatgatatgccgtcctggctcgaaaaactggagctctcg
gaacgtgagctgacaaaatacatcatcggcacgatcagcggtctggatacgcctctgacc
aactccatgcgtttggagcaggctggagtttatcatctaaaacaggtagatacggcaatg
cggcagcaaatgcgcagtgagatcatagacctgacgaatgccgacctgcagaagctggcg
ccgctgatcagggatacactaagcgagaagtatttgtgtgttgtgggcagcagccaaagt
atcgaagctaataaaaatatttttactaaaactcagcatatttaa

DBGET integrated database retrieval system