KEGG   Planococcus faecalis: AJGP001_00620Help
Entry
AJGP001_00620     CDS       T04955                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pfae  Planococcus faecalis
Brite
KEGG Orthology (KO) [BR:pfae00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pfae03012]
    AJGP001_00620
   03029 Mitochondrial biogenesis [BR:pfae03029]
    AJGP001_00620
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfae04147]
    AJGP001_00620
Translation factors [BR:pfae03012]
 Eukaryotic Type
  Elongation factors
   AJGP001_00620
 Prokaryotic Type
   AJGP001_00620
Mitochondrial biogenesis [BR:pfae03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AJGP001_00620
Exosome [BR:pfae04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AJGP001_00620
  Exosomal proteins of breast cancer cells
   AJGP001_00620
  Exosomal proteins of colorectal cancer cells
   AJGP001_00620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AQU77900
LinkDB All DBs
Position
129285..130472
Genome map
AA seq 395 aa AA seqDB search
MGKAKFDRSKTHANIGTIGHVDHGKTTLTAAIATVLAKKSGGEARSYAQIDNAPEEKERG
ITINTSHVEYETESRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRQVGVPYLVVFMNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDIPVIKGSALKALE
GEAEWEDKIVELMNAVDEYIPTPPRDTEKPFMMPVEDVFSITGRGTVATGRVERGQIKIG
DNVDIIGLTEEPKSTTVTGVEMFRKLLDYAEAGDNIGALLRGVSRDDVQRGQVLAKPGTI
TPHTEFRAEVYVLSKEEGGRHTPFFTNYRPQFYFRTTDVTGVCNLPEGVEMVMPGDNIEM
IVSLISPIALEEGTKFSIREGGRTVGAGVVATITK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagctaaatttgatcgctctaaaacacatgcaaatattggtacaattggtcac
gtcgatcacggtaaaacaactttgactgcagcaatcgctacagttcttgctaaaaaatca
ggcggagaagctcgttcttacgctcaaatcgataacgcacctgaagaaaaagagcgcggt
atcacaatcaatacttcacacgttgagtatgaaactgaatctcgccactacgcacacgta
gattgccctggacacgccgattatgttaaaaacatgattactggtgctgctcaaatggac
ggcggaatcttagtagtatctgctgctgacggcccaatgccacaaactcgtgagcacatc
cttctttcacgtcaagtcggtgttccttacctagttgtattcatgaacaaatgcgatatg
gtagatgacgaagaacttcttgaactagttgaaatggaagtccgcgatcttctttctgaa
tatgacttccctggcgatgacattcctgtcatcaaaggatctgctcttaaagctcttgaa
ggagaagctgagtgggaagacaaaatcgttgaattaatgaacgcggttgatgagtatatc
cctactccaccacgtgatactgaaaaaccattcatgatgcctgttgaggatgtattctca
atcactggccgtggaactgttgctactggacgcgttgaacgtggacaaatcaaaatcggt
gataacgttgatatcattggtcttactgaagaaccaaaatctacaactgtaactggtgta
gaaatgttccgtaaattacttgactatgctgaagctggcgacaacattggcgcacttctt
cgcggagtttctcgtgatgacgttcaacgtggacaagtattggctaaaccaggcacaatt
actccacatactgaattcagagcggaagtttacgttctttcaaaagaagagggtgggcgt
catactccattcttcacaaactaccgtccacagttctacttccgtacaactgatgtaact
ggtgtttgtaaccttcctgaaggtgtagaaatggttatgcctggagataacatcgaaatg
atcgtttctctaatctctcctatcgcacttgaagaaggaactaagttctctatccgtgag
ggtggacgtactgtaggcgctggcgttgttgctacaattactaagtaa

DBGET integrated database retrieval system