KEGG   Planococcus faecalis: AJGP001_05545Help
Entry
AJGP001_05545     CDS       T04955                                 

Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
pfae  Planococcus faecalis
Pathway
pfae00340  Histidine metabolism
pfae01100  Metabolic pathways
pfae01110  Biosynthesis of secondary metabolites
pfae01230  Biosynthesis of amino acids
Module
pfae_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pfae00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    AJGP001_05545
Enzymes [BR:pfae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     AJGP001_05545
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     AJGP001_05545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AQU78771
LinkDB All DBs
Position
1121364..1121990
Genome map
AA seq 208 aa AA seqDB search
MTTIQYDPSGLIPVIIQNAETKEVLTLAYANEEAVQKTMATNETWLYSRSRSELWNKGAT
SGNTQKVTAVRLDCDGDSLIYEVIPNGPACHTGKDSCFFETIHGERNESPGDMFAQLTAL
IEAREKEMPEGAYTTYLFEEGIDKICKKVGEEAAEVIIAAKNRDAEELSMETADLLYHVL
VLLQEQKVNFNKVTNVLKQRHETKATSK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccatacaatatgatccaagcgggctgattcccgtgataatccagaatgccgaa
acaaaagaagtgttaactttggcttatgccaacgaagaagccgtccaaaaaacaatggct
acaaatgaaacgtggctttactcaagaagccgtagtgaattgtggaacaaaggtgcgacg
agtggtaacactcaaaaagtgacggctgtgcgattagattgcgacggcgattcgctaatt
tatgaagtaattccaaatggccccgcttgtcatacgggtaaagatagctgcttttttgaa
accattcatggtgagcgcaatgaatctccaggcgatatgttcgcacaattgaccgcgtta
atcgaagcgcgtgaaaaagaaatgcctgaaggggcgtatacgacttatctgtttgaagaa
ggcatagataaaatttgtaaaaaagtaggcgaagaagcagctgaagtgattatcgcagcc
aaaaatcgtgacgctgaagagctatcaatggaaacagccgatttgttgtatcatgtgttg
gtgcttttacaagaacaaaaggtaaactttaacaaagtgaccaatgtattaaaacaacgt
catgaaacaaaagcgacaagtaaataa

DBGET integrated database retrieval system