KEGG   Planococcus faecalis: AJGP001_11500Help
Entry
AJGP001_11500     CDS       T04955                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pfae  Planococcus faecalis
Brite
KEGG Orthology (KO) [BR:pfae00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pfae01001]
    AJGP001_11500
Enzymes [BR:pfae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AJGP001_11500
Protein kinases [BR:pfae01001]
 Serine/threonine kinases: Other
  Bacterial family
   AJGP001_11500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like RIO1 Kdo Seadorna_VP7 Pkinase_fungal Haspin_kinase FTA2 MAGI_u1
Motif
Other DBs
NCBI-ProteinID: AQU79855
LinkDB All DBs
Position
complement(2265044..2267017)
Genome map
AA seq 657 aa AA seqDB search
MLIGKSINGRYKIKELIGGGGMSNVYLAHDMILDRDIAIKILRYDFSNEEELRRRFQREA
LSTTSLAHPNIVNIFDVGEDKSIHYLVMEYVPGKTLKEYIIEHSPVAPERAVEIMRQLAS
ALAHAHHNQIVHRDIKPQNILMDAEGNVKISDFGIAMALSATSYTQTNSVLGTVHYLSPE
QARGGTANKKSDIYSLGIVMYELITGKLPFSGESAVSIALKHLQTETPSLRDTVPSLPQS
LENVVLKATAKNVQHRYQSADEMEADLATVLMPERLNEPKFVVPVDQDETRAMPAIKDPA
AYGSEANTKTMPLPIKKVEEQQKAPIKKKKKKWPWIIGVLSFLLLAGLVQAIAFPGLFEP
RQVAVPDVSEMERTEAVEELQAAGFVIGDETEGYSEEIAENHVIRTIPEAGKMRDRETKV
QLFVSIGKEKVEMADFIGNTLEEATKSLNDKEFASVKPTEEFSEEPVGTILSQQPAAGEE
VIVSETDVEFIVSKGEDLRNVEDLAGFTEANLNDYARSSGFNIRIVSEQASDAVEAGKVM
SQSPAAGEQLVAGGTIEVTLSAGEAEQPLKTYIHTAEIPYEPAQPAAEGEEPVKQTIQVY
IQDNTHTMVEPFEEFTITEDQSHRIELQIAQGQSASYRIVRDSTIILEETFDYSTVE
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgttgattggaaaaagtatcaacggccgctataagatcaaggaattgatcggtggcggt
gggatgtccaatgtatatttagcacatgacatgattttggaccgggatatcgccatcaag
attttgcgttatgatttctctaatgaagaagaattgcgtcggcgctttcaaagagaagcc
ttgtctacgactagtttggcacatcccaatatcgtgaacatttttgatgtgggcgaagat
aagtcgattcattacttggtcatggaatacgttccaggaaaaaccttgaaagaatacata
atcgaacattcaccagtagctcctgagcgtgctgttgagattatgaggcaattggcgtcg
gctttggcgcatgcccaccacaaccaaatcgtccatcgggacattaagccgcaaaatatt
ttgatggacgcagaaggcaatgtaaaaatatccgatttcggaattgcaatggcgttaagt
gcaacatcctatacgcaaacaaattcggtactaggaaccgtccattatttgtcgccagaa
caggcacgaggtggtacagccaataagaaatccgatatctattcactcggaattgtaatg
tacgaattaattactggtaagttaccattttcaggcgagtcagctgtttctattgcatta
aagcatctacaaacagaaacaccttcactgcgtgacacggttccttctttgccacaaagc
ttggaaaatgtcgtcttaaaagcaactgctaaaaatgtgcaacatcgttatcaatctgct
gacgaaatggaagcagatctcgcgactgttttgatgccagagcgactaaacgaaccaaaa
ttcgttgtgccagtggaccaagatgaaacacgtgccatgccagcaattaaagacccggca
gcttatggtagcgaggcaaacacaaaaacaatgccgctacctattaaaaaagtagaagaa
caacaaaaagctcctatcaaaaagaagaaaaagaaatggccgtggattattggggtgttg
tctttcttattactagctggtctggtgcaagcaattgcatttcctggactgtttgagccg
cgacaagtagcagtgcctgatgtttcagaaatggaacgcaccgaagcggtagaagagcta
caagcagctggctttgttataggcgatgaaaccgaagggtattcagaagaaatagcagaa
aatcatgtgattcgaacaattccagaagctgggaaaatgagggaccgtgaaaccaaagtt
cagttatttgttagtattgggaaagaaaaagtcgaaatggctgattttatcggcaacacg
ctagaagaagccacaaaatctctaaacgacaaagagtttgcttcagtaaaacctactgaa
gaattttctgaagaaccggttgggaccattttgagtcaacaaccagcagctggtgaagaa
gtgattgtcagtgaaacggatgttgagtttatagtgagtaaaggtgaagaccttcgaaat
gtagaagatttagctggatttacagaagcaaatctgaacgactatgctcggtcttcgggg
tttaatatccgtattgtttcagaacaagcatcagatgcagtagaagctggaaaagttatg
tctcaaagcccagcagctggagaacaactcgtagcgggtggaacgattgaagtgacatta
tcagcaggcgaagcagaacagccactgaagacttacattcacacggcagaaattccgtat
gaaccggcccagcctgctgctgaaggtgaagaaccggtcaaacagaccattcaagtttat
attcaagacaatacacatacaatggtagagccatttgaggagtttaccattactgaagat
caatctcatcgcattgagttgcaaatagcacaaggtcaaagtgcctcttaccgaattgtt
cgtgattccacaattattttagaagaaacctttgattattcaactgtagaatag

DBGET integrated database retrieval system