KEGG   Planococcus faecalis: AJGP001_12755Help
Entry
AJGP001_12755     CDS       T04955                                 

Definition
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
pfae  Planococcus faecalis
Pathway
pfae00260  Glycine, serine and threonine metabolism
pfae00261  Monobactam biosynthesis
pfae00270  Cysteine and methionine metabolism
pfae00300  Lysine biosynthesis
pfae01100  Metabolic pathways
pfae01110  Biosynthesis of secondary metabolites
pfae01120  Microbial metabolism in diverse environments
pfae01130  Biosynthesis of antibiotics
pfae01210  2-Oxocarboxylic acid metabolism
pfae01230  Biosynthesis of amino acids
Module
pfae_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
pfae_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pfae00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AJGP001_12755
   00270 Cysteine and methionine metabolism
    AJGP001_12755
   00300 Lysine biosynthesis
    AJGP001_12755
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    AJGP001_12755
Enzymes [BR:pfae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     AJGP001_12755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT ACT_7 DUF5376
Motif
Other DBs
NCBI-ProteinID: AQU80093
LinkDB All DBs
Position
2522517..2523881
Genome map
AA seq 454 aa AA seqDB search
MKVSKFGGTSVASAQQIKKVAAIVKAEPSRKIVVVSAPGKRFDGDVKMTDLLIHLSAAAL
RDEPTATPLANVMERYAEIADGLGLDEDIKKIIKTDLLNRLQADKSSPPLFADLIKASGE
DNSAKLIAAYLTSIGLAAEYVNPFDAGLFVNDLPERAQALPEAYDNLSDLRNKKTITVFP
GFFGYTKRGQLRTFERGGSDITGSILAAAVQAELYENFTDVDCVFAANPRVVENPVEIEQ
MTYREMRELSYAGFAVLHDEALMPVFKASVPLCIRNTNNPSAPGTMIVAERDHSLRPVTG
ISADSGFSTLYVSKYLMNREVGFGRRLLQILEDEDISYEHIPSGIDNLSVILRSHQLTVD
KEQRIVERVKSELQADDVHIRSDFSMIVLVGEGMNNQKGLTARAANAFARTGVNIEMINQ
GSSEVSLVFGILKEDEQKILNELYKEFFEPALVH
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagcaaatttggcgggacatcagtagctagtgcacaacagataaaaaaagtg
gctgcaattgttaaagcagagccttctcgcaaaatcgtcgttgtctctgctccaggcaag
agatttgatggagacgtaaaaatgacagatttgctcattcatctatcagcagcggcatta
cgtgacgaaccaacagcaactcctcttgccaacgttatggaaagatatgctgaaatcgct
gatggattaggactagacgaagacatcaagaaaatcattaaaaccgatttgttgaaccgt
cttcaagcagacaaaagttcacctcctctttttgcagacttaattaaagcgagcggtgaa
gataactctgcgaaactaatagctgcttacttaacatctatcgggttagctgcagaatac
gtcaatccatttgatgcagggttgtttgtaaatgacttacccgagcgtgcacaagctctt
ccagaagcttacgacaatttgtctgacttgcgcaacaaaaaaacgataactgttttccca
ggctttttcgggtatacaaaaagaggccaattaagaactttcgaacgcggtggctcagat
attaccggctctattttagcagctgcggttcaggcagagttatatgaaaactttaccgat
gtggactgcgtctttgcagctaatccccgtgttgttgaaaaccctgttgaaatcgaacaa
atgacttaccgtgaaatgcgtgagctttcctatgctggatttgcggttcttcacgacgaa
gcccttatgcctgtctttaaagcgtctgttcctttatgtatccgtaataccaacaatcca
tcagcacccggaacgatgattgttgcagagcgagatcattccttacgtcctgttacaggc
atatcagctgatagtggcttctcaactttatacgtcagtaaatacttgatgaaccgcgaa
gttggttttggccggagactgctgcaaatattagaagacgaagatatctcatatgaacac
atcccgtctggtattgataacctttccgttattttgcgcagtcaccaattgactgttgat
aaagagcagcgcattgtagaacgcgttaaatcagaactgcaagctgatgacgttcacatc
cgaagtgatttttctatgattgttcttgttggagaaggcatgaacaatcaaaaaggactg
acagctcgtgccgcgaacgcttttgctagaactggtgtcaatattgaaatgatcaaccaa
ggctcttctgaagtgagtttggtgtttggcatcttgaaagaagatgaacaaaaaatattg
aacgaattgtacaaagaattctttgaacctgctttggttcattaa

DBGET integrated database retrieval system