KEGG   Planococcus faecalis: AJGP001_14460Help
Entry
AJGP001_14460     CDS       T04955                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
pfae  Planococcus faecalis
Pathway
pfae00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:pfae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AJGP001_14460
Enzymes [BR:pfae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AJGP001_14460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AQU80408
LinkDB All DBs
Position
complement(2906125..2907606)
Genome map
AA seq 493 aa AA seqDB search
MKLTNFVNGKWQQAEHAEFRPVLNPANGEELAQVRMSTAQDVDLAVKAALGAQKKWAKVP
APRRADYLYEIGRLMKERKEHLAQVLTKEMGKVIEEGRGEVQEGIDMAYYMAGEGRRMFG
ETTPSELADKFAMSIRSPIGVVGLITPWNFPVAIATWKSFPAIVGGNAFIWKPATETPMM
AYEMAKIFEEVGLPEGVANIVFGAGSEVGTALIEHEGVRVISFTGSTETGRKVAEAGGRN
LKKVSLEMGGKNAVIVMEDADLDLAVEGILWSAFGTAGQRCTACSRVIVHADVKQELQKR
LLSKMETLTIGDGTDETIKIGPVINRKAVEKIHSYIEIGQQEGATLLVGGEILTGGIYDK
GNYYAPTLFTDVKPEMRIAQEEIFGPVVSIIEVATFEEAIDVNNGVIYGLSSSIYTADVN
RAFKAQRDLDTGIVYINAGTTGAEIHLPFGGTKGTGNGHRDSGVAALDVFTEWKSVYVDY
SGKLQRAQIDNEA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgactaattttgtgaatggtaagtggcagcaggcagaacatgcggaatttaga
cctgttttgaatccggcaaatggggaagagctggcacaagttcgaatgtctacagcacag
gatgtcgacttagcagtaaaggcagcactaggagcacaaaaaaagtgggcaaaagtaccg
gcacctagacgtgcggattatttatatgaaattggtcgactgatgaaagagcgaaaagaa
cacctcgctcaagtgttaacgaaagaaatggggaaagtgattgaagaaggtcgtggtgaa
gtacaagaaggaattgacatggcttattatatggcgggagaaggaaggcgcatgttcggc
gaaacaaccccgtcagaactggccgacaaattcgcaatgagcatccggtcaccaattggt
gtcgtaggattgatcactccgtggaacttccctgtagcaattgccacgtggaaatcattt
cctgcaattgttggaggcaatgcatttatttggaaacctgcaacggaaacgccgatgatg
gcctatgagatggcaaagatttttgaagaagtgggtcttccagaaggtgtcgctaatatt
gtttttggagccggctcagaagtaggcacagcacttatcgaacatgaaggcgtaagggtt
atctcatttacaggatcaacagaaaccggtcgcaaagtagcagaagcaggagggcgcaac
ttgaaaaaagtatctctcgagatgggtgggaaaaatgccgtcatcgttatggaagatgct
gatttagatttagccgtagaaggtattctttggagtgcatttggtacagctggtcagcgt
tgcacagcttgtagccgggtaattgttcatgccgatgtaaagcaagaactgcagaaacgg
ctgctttcgaaaatggaaactttgacaattggagatggtacagacgaaaccatcaaaatc
ggaccggttatcaatcgaaaagcagtcgaaaaaattcattcctatattgaaatcggccag
caagaaggagctaccttactggttggtggagagattttgaccggcggtatttacgacaaa
gggaactattacgctccgacattgttcacggatgttaaacccgaaatgcgcattgcgcaa
gaagaaatttttggtcctgttgtatcaattatcgaagtggcaactttcgaagaagcaatt
gatgtgaacaatggtgtgatttacgggttgtcgagttcaatttatacagctgatgtaaat
cgtgcatttaaagcgcaacgtgatttagataccgggattgtctacattaatgcgggaacg
accggagcggaaattcacttgccgtttggtggaactaaagggactgggaatggtcaccgt
gattcaggcgttgcggcattggacgtttttacagaatggaagagtgtctatgttgattac
agtgggaagttgcagcgtgcgcaaatcgataacgaagcttga

DBGET integrated database retrieval system