KEGG   Pseudomonas synxantha LBUM223: VO64_0092Help
Entry
VO64_0092         CDS       T03769                                 

Definition
(GenBank) Trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pfb  Pseudomonas synxantha LBUM223
Pathway
pfb00500  Starch and sucrose metabolism
pfb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VO64_0092
Enzymes [BR:pfb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VO64_0092
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     VO64_0092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap MMPL
Motif
Other DBs
NCBI-ProteinID: AKA80638
UniProt: A0A0E3MI83
LinkDB All DBs
Position
113436..116783
Genome map
AA seq 1115 aa AA seqDB search
MAKKPKAATFIKDPLWYKDAVIYQVHVKSYFDSNNDGIGDFPGLIAKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVHSDYGTMADAKRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARKAKPGSAARDFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLSVMRYWLDLGIDGLRLDAIPYLIERDGTNNENLAETHDVLKQIRA
EIDAHYPDRMLLAEANQWPEDTQLYFGDRKGDDGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDRERDYLWNYYAADRRARINLGIRRRL
APLMERDRRRVELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRADPASLVLPPIMDAQYGYQSVNVETQAQDPHSLLNWTRRMLAVRKQSKAFGRGSLKM
LSPTNRRILAYTREYTGEDGRSEIILCVANVSRSAQAAELDLSAFAGMVPVEMLGGNAFP
PIGQLNFLLTLAPYGFYWFVLAAENQMPSWHVEPAQSMPDFTTLVLKKRMEELLEEPCRT
SLEQTSLPAWLPKRRWFAGKDTAIDSVHIAYGVRFGDPQHPVLLSEIEVTSGGQVSRYQL
PLGFLGEDQFTSALPQQLALARVRRTRQVGLVTDAFSLEQFIREVIQAMQAGTVLSSVEG
DLRFESTQHLAGLQLGSESPVRYLSAEQSNSSVVVGESLVLKLIRKVSAGVHPELEMSAY
LTAAGYPNISPLLGSMSRRDGQGQDNLLMIAQGYLSNQGDAWSWTQNNLERAIRDELAEA
ISEQEQHYNALGELADFAGLLGQRLGEMHLVLGAPTADKAFKPELTTAKDTQAWAKDVGA
QIDRALQLLKLHQSQLNPADQALVSELLAQKKAIAGHVQALAKATLGGLRLRVHGDLHLG
QVLVVKGDAYLIDFEGEPARPLHERRGKHSPYKDVSGVLRSFDYAAAMALNVQGVDHSPE
ADNARKRVTDRYLNEARQAFTQAYQAATATLAHDWQDAKGQDAALTLFSLEKAAYEVAYE
AENRPTWLPVPLQGLHGLLSGLTPKSKPVRGGETS
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaacccaaggcagccacctttatcaaagacccgctctggtacaaagatgcg
gtgatctatcaggttcacgtcaaatcctatttcgactccaacaacgacggcatcggtgac
tttcccgggctgattgccaagctcgactacattgccgacctcggtgtgaacaccatctgg
ctgttgccgttctacccttcgccacgccgtgatgacggctacgatattgccgagtaccgt
ggcgtacacagcgactacgggaccatggccgacgccaagcgcttcattgccgaagcccac
aagcgtgggctgcgggtgatcaccgagctggtgatcaaccacacctccgaccagcacccc
tggttccagcgtgcgcgcaaggccaagccgggctcggcggcacgggatttctacgtatgg
tcggacgatgaccagaagtacgacggcacgcgcattattttcctcgacaccgaaaagtcc
aactggacctgggacccggtggcgggccagtacttctggcaccgcttctattcgcaccag
cccgacctcaacttcgataacccgcaagtgatgaaagcggtgctgtcggtgatgcgctat
tggctcgacctgggcatcgacggcttgcgcctggatgccatcccctacctgatcgaacgc
gacggcaccaataacgaaaaccttgcggaaacccacgacgttctcaagcagatccgtgcc
gaaatcgacgcccattaccctgaccgcatgctgctggccgaggccaaccaatggccggaa
gacacccagctgtactttggcgaccgcaagggcgatgacggcgatgaatgccacatggcc
ttccactttccgctgatgccgcgcatgtacatggcattggcccaggaagatcgcttcccc
atcactgatattttgcgtcagaccccggagattcccgccaattgccaatgggcgatcttc
ctgcgcaaccacgatgaactgaccctggaaatggtcaccgacagggagcgcgactacctg
tggaactactacgccgccgaccgccgcgcgcgtatcaacctgggcatccgccggcgcctg
gcgccgctgatggagcgcgatcgccgccgtgtggagttgctcaatagcctgttgctgtcg
atgccgggcacgccgaccttgtattacggcgatgaaattggcatgggtgacaacatctat
ctgggcgaccgcgacggcgtgcgtacaccgatgcaatggtccatcgaccgcaacggcggt
ttttcccgcgccgacccggccagcctggtgttgccgccgatcatggacgcgcaatacggt
tatcagtcggtcaacgtcgaaacccaggcccaggacccgcactcgctgctcaactggacc
cgacgcatgctcgccgtgcgcaagcagtcaaaggcgtttggccgtggcagcctgaaaatg
ctttcgccaaccaatcgccgcattcttgcctatacccgtgagtacaccggcgaagatggc
cgcagcgagatcatcctgtgcgtggccaacgtgtcgcgcagcgcccaggctgcggagctg
gacctgtctgcgtttgccggcatggtgccggtggaaatgcttggcggtaatgcgttccca
cccatcggccagctgaatttcctgttgaccctggcgccctatggcttctactggtttgtg
ctggcggcggagaaccaaatgcccagctggcatgtggaaccggcgcaaagcatgcctgac
ttcaccaccttggtactgaaaaaacgcatggaagaattgttggaagaaccttgccgcacc
agtcttgagcaaacctcattgccagcctggctgcccaagcgtcgctggtttgccggcaaa
gacacggccattgacagcgtgcacatcgcttacggtgttcgcttcggcgacccgcagcac
ccggtgctgctcagtgaaatcgaggtaaccagtggcggccaggtcagccgttatcaattg
ccgttgggctttctgggcgaagaccagttcaccagtgccttgccccagcaattggccctg
gctcgcgtgcggcgtacccgccaggtagggttggtgactgatgcgttcagccttgagcag
tttatccgtgaggtgatccaggccatgcaggccggtaccgtgctcagttccgttgagggc
gatctgcgtttcgagtcgacccaacacttggccgggctgcaactgggcagcgaatcgccg
gtgcgctacttgtccgccgagcagtccaacagctcggtggtagtgggcgagagcctggtg
ctcaagttgatccgcaaagtcagcgccggggtgcacccggagctggaaatgagtgcctac
ctgaccgccgccggctacccgaatatttcgccattgctgggttcgatgagtcgccgcgat
gggcaaggccaggacaacctgctgatgattgcccaaggctacctcagcaatcagggcgat
gcctggagctggacccagaacaacctggagcgggcgatccgcgacgaactggccgaggcc
atctccgaacaggagcagcactacaacgccttgggggaactggcggatttcgccgggctg
cttggccagcgcctgggggaaatgcacctggtgctgggcgcgccgaccgccgacaaggct
ttcaagcccgaactcaccacggccaaggatacccaggcctgggccaaggatgtcggcgcc
cagatcgaccgcgccctgcaactgctcaaacttcatcaaagccagttgaaccccgctgat
caggcgttggtcagtgaattactggcgcagaaaaaagccatcgccgggcatgtccaggcg
ctggcgaaggccacgctaggcgggttgcgtctccgggtgcatggagacttgcatctgggc
caggtattggtggtcaagggcgatgcctacctgatcgactttgaaggcgaaccggcgcga
ccactgcatgaacggcgtggcaaacacagcccctataaagatgtgagtggtgtgttgcgc
tccttcgattacgcggcggccatggccctgaatgtgcaaggagtggatcactcgccggaa
gcggacaacgcgcgtaaacgcgtgaccgatcgctacctgaatgaagcccgccaggcattt
acccaggcctaccaggcggcgacggctacactggcccatgattggcaggatgccaagggc
caggacgcagcgctgacgttgttcagcctggagaaggctgcgtacgaagtggcctacgaa
gcggaaaatcgcccgacctggttgccggtgcccctgcaagggctgcacggtttgctcagc
gggctaacacctaaatcgaaacctgtacgcggtggggagacctcatga

DBGET integrated database retrieval system