KEGG   Pseudomonas synxantha LBUM223: VO64_0401Help
Entry
VO64_0401         CDS       T03769                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pfb  Pseudomonas synxantha LBUM223
Brite
KEGG Orthology (KO) [BR:pfb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VO64_0401
Enzymes [BR:pfb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     VO64_0401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO FAD_oxidored AlaDh_PNT_C FAD_binding_3 Thi4 NAD_binding_8 Glutaredoxin FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AKA80947
UniProt: A0A0E3MLQ0
LinkDB All DBs
Position
complement(457041..458606)
Genome map
AA seq 521 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLQDVISLTTLITLKTDGDDAR
RPSFSINRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQICALKGEFSF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVDERQIMAVPSVYLNGVNF
GQGRMGLEEILAKLDTSGIEKAAEKISAKDAFDVLVVGGGPAGSSAAIYAARKGIRTGVA
AERFGGQVLDTMSIENFISVQETEGPKLASALEAHVRQYDVDIMNLQRASSLVPAKNPGE
LHEIRFESGATLKSKTVILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGLVSHVTLLEFDSKLRADAVLQRKLYSLPNVDVITSALTSEVKGDG
QKVTGLAYKDRDSGEFKTIDLEGIFVQIGLLPNTDWLKGTVELTPRGEIIVDARGETSLP
GVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagctcagttgaagtcatacctggaacgggtcacccagccg
atcgagatcgtcgcctccctcgacgacggcgcgaaatcccaggaaatgcttgctctttta
caggacgtcatcagcctcaccacgctgattaccctgaaaaccgatggcgatgatgcgcgc
aggccgtcgttctccatcaaccgcccgggtgccgatatcagcctgcgcttcgccggcatc
cccatgggtcatgaattcacttcgttggtgctggccctgctgcaagtcggtggccacccg
tcgaaggccagtgtcgaggtgattgaacagatttgtgccctcaaaggcgagttcagcttc
gagacttacttctcgctgtcgtgccagaactgcccggacgtggtacaggccttgaacctg
atggccgtgctgaacccgaacatccgccacgtcgccatcgacggtgcgctgttccaggcc
gaggtcgacgagcgccagatcatggcggtgccgagtgtctacttgaacggggtcaacttc
ggccagggccgtatgggcctggaagaaatccttgccaagctcgacaccagcggtatcgaa
aaagccgcggaaaagatcagcgccaaagacgcctttgacgtcctcgtcgtcggcggtggc
ccggccggttcttcggcagccatctatgcggctcgcaaaggcattcgtaccggagttgcc
gccgaacgttttggtggccaggtactggataccatgtcgatcgagaactttatctcggta
caggaaaccgaagggccgaagctggccagtgcgttggaagcgcatgtgcgccagtacgac
gtggacatcatgaatctgcaacgtgccagtagcctggtgccggcgaaaaatcctggtgag
ttgcacgaaattcgcttcgaaagcggcgcgaccctcaagtccaagaccgtgatcctggct
actggcgcccgctggagagagatgggcgttccgggcgagcaggaatacaaggccaagggc
gtttgcttctgcccgcactgcgacggcccattgttcaagggcaagcgcgtggcggtgatc
ggcggcggtaactccggtgttgaggctgccattgacctggccgggctcgtcagccatgtc
acgctgctcgagttcgacagcaagttgcgcgctgatgcggtattgcaacgcaagctctat
agcctgccgaacgtggatgtgattaccagcgcgctgaccagtgaagtcaagggcgacggc
cagaaagtcaccggtcttgcctacaaggatcgcgacagcggcgagttcaagaccatcgac
ctggaaggtatctttgttcagatcggcttgctgcccaacaccgattggctcaagggcact
gtagagctgactccgcgcggcgagatcatcgtcgatgcccgtggcgagacctcattgcca
ggcgtgtttgccgccggtgacgtcactaccgtgccttacaagcagattgtgatcgctgtg
ggtgagggggccaaggcttcgttgagcgcctttgatcacttgattcgtacgtcggctccg
gcataa

DBGET integrated database retrieval system