KEGG   Pseudomonas synxantha LBUM223: VO64_1078Help
Entry
VO64_1078         CDS       T03769                                 

Definition
(GenBank) Xylitol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
pfb  Pseudomonas synxantha LBUM223
Brite
KEGG Orthology (KO) [BR:pfb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VO64_1078
Enzymes [BR:pfb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     VO64_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 DUF43 FAM72 Cpn10
Motif
Other DBs
NCBI-ProteinID: AKA81624
UniProt: A0A0E3MMM8
LinkDB All DBs
Position
complement(1218256..1219347)
Genome map
AA seq 363 aa AA seqDB search
MDKHTHMQAVVCHGPKDYRLERIGKPQARANELVIRIAACGICASDCKCHSGAAMFWGGD
NPWVKAPVVPGHEFFGYVVEAGEGAEEHFEVKVGDKVIAEQIVPCAKCRFCKSGKYWMCE
VHNIFGFQREVAEGGMAQYMRIPKTAIVHRIPEAVSLEDSALVEPMACSIHTVNRGDIQL
DDVVVIAGAGTLGLCMVQVAALKTPKKLVVIDMVDERLELAKKFGADVVINPARDNAREI
INGLTDNYGCDVYIETTGVPAGVTQGLDLIRKLGRFVEFSVFGAETSVDWSIIGDRKELD
VRGAHLGPYCYPIAIDLFERGLVTSKGIVTHDFPLDDFAEAFELANSTKSIKVLLKPVLP
AHE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggacaagcacacccacatgcaagccgtcgtctgccacggcccgaaagactaccgcctg
gaacgcatcggcaagccccaggcccgcgccaatgagctggtgatccgcatcgccgcctgt
ggcatctgcgccagcgactgcaagtgccactcgggcgcggcgatgttctgggggggcgac
aacccctgggtcaaggcgccggtggtgccgggccacgaatttttcggctacgtggtggaa
gcgggcgagggcgccgaggagcactttgaggtcaaggtcggtgacaaggtcatcgccgaa
cagatcgtgccctgtgccaagtgccgcttctgcaaatcgggcaaatactggatgtgcgaa
gtgcacaacatcttcggcttccagcgcgaagtggccgaaggcggcatggcccagtacatg
cgcatccccaagactgccatcgtgcacaggattcccgaggcagtgtccctggaggattcg
gcgctggtggagccgatggcctgctcgatccataccgtcaaccgtggcgatatccagctc
gacgacgtggtggtgattgccggcgcgggcaccctcggcctgtgcatggtccaggtggcg
gcgctgaagaccccgaaaaaactggtggtgatcgacatggtcgacgagcgcctggaactg
gcgaaaaaattcggcgccgatgtggtgatcaacccggcccgtgacaatgctcgcgagatc
atcaacggcctcactgacaactacggctgtgacgtctacatcgaaaccaccggcgtaccg
gcgggcgtcactcaaggcctggacctgatccgcaagctcgggcgcttcgtcgagttcagt
gtatttggcgccgagaccagcgtcgactggtcgatcatcggcgaccgcaaggaactcgac
gtgcgtggtgcgcaccttgggccgtattgctacccgatcgccatcgatctgttcgaacgc
ggcctggtcacctccaaaggcattgtcacccatgatttcccgctggacgacttcgccgaa
gccttcgagctggccaactccaccaagtcgatcaaggtgctgttgaagccggtgctgccc
gcccatgagtaa

DBGET integrated database retrieval system