KEGG   Pseudomonas synxantha LBUM223: VO64_2945Help
Entry
VO64_2945         CDS       T03769                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pfb  Pseudomonas synxantha LBUM223
Pathway
pfb00010  Glycolysis / Gluconeogenesis
pfb01100  Metabolic pathways
pfb01110  Biosynthesis of secondary metabolites
pfb01120  Microbial metabolism in diverse environments
pfb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VO64_2945
Enzymes [BR:pfb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     VO64_2945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AKA83491
UniProt: A0A0E3GZ07
LinkDB All DBs
Position
3275108..3276007
Genome map
AA seq 299 aa AA seqDB search
MPTPHVETVKVDELDCWRIRHNGAELMVARQGAHIFSYQREGEQPLIWPNPKAVFKQGKG
IRTGVPVCWPWFGVFDRNPQSVKAMRQSDQPAGSHGFARTALWELAETAIEGEALRIELA
LPVPPNGFPGWPHQVDLTLSLLLDDQLHIRLTSHNRGTDTVTLSQALHTYFAVSDVRNVQ
VEGLDGLAYIDTADGWTEKRQAGLLHFTAETDRIYLDTPAQLSIVDKDWQRRVKLTSQGS
NSTVVWNPWTERAKALDDMADDGWQGMLCIETANVLDDVVSLAAGESHTLGVSITSITL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcctacgccccacgttgaaacggtgaaagtcgacgagctggactgctggcgcattcgc
cacaacggcgccgaactgatggtggcccggcagggcgcgcacatcttcagttaccagcgc
gagggcgagcagccgctgatctggcccaaccccaaggcggtattcaagcagggcaaaggc
attcgtaccggcgtgccggtgtgctggccgtggtttggtgtattcgaccgtaacccgcaa
agcgtcaaggcgatgcgtcaaagcgatcaaccggctggctcacatggctttgcgcgcacc
gccctctgggaattggccgagactgcaatcgaaggtgaagccctgcgtatcgaactggcg
ctgccggttcctccgaacggctttcccggctggcctcaccaggttgacttgacgctgagc
ctgctgctggacgaccaattgcatattcgcctcaccagccacaaccgtggcaccgacacc
gtgaccctcagccaggcgctgcacacctactttgctgtgagcgatgtgcgcaacgtgcag
gtcgagggcctggatggcttagcatacatcgataccgccgacggctggaccgagaagcga
caagccggcctgctgcacttcaccgccgagacggatcgcatctacctggacacgccggcg
cagttgagcattgtcgataaggactggcagcgccgcgtcaaactcaccagccagggctcg
aactcgacggtagtctggaacccctggaccgaacgagccaaggcgctcgatgacatggct
gacgatggctggcagggcatgttgtgcatcgagacggcgaatgtgctggatgatgtggtg
agcctggcggccggtgaaagccacaccttgggcgtgagcatcaccagtatcaccttgtaa

DBGET integrated database retrieval system