KEGG   Pseudomonas synxantha LBUM223: VO64_3943Help
Entry
VO64_3943         CDS       T03769                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit A Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pfb  Pseudomonas synxantha LBUM223
Pathway
pfb00970  Aminoacyl-tRNA biosynthesis
pfb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    VO64_3943
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pfb03029]
    VO64_3943
Enzymes [BR:pfb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     VO64_3943
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     VO64_3943
Mitochondrial biogenesis [BR:pfb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    VO64_3943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AKA84489
UniProt: A0A0E3KGZ0
LinkDB All DBs
Position
complement(4447794..4449245)
Genome map
AA seq 483 aa AA seqDB search
MHHMTLAEIARGLADKTFSSEELTQTLLARIAEHDPKVNSFISLTEELALSQAKAADARR
ANGENGALLGAPIAHKDLFCTQGIRTSCGSKMLDNFKAPYDATVVSKLAAAGAVTLGKTN
MDEFAMGSANESSYYGAVKNPWNLEHVPGGSSGGSAAAVAARFLPAATATDTGGSIRQPA
AFTNLTGLKPTYGRVSRWGMIAYASSLDQGGPLARTAEDCAILLQGMAGFDKQDSTSIDE
PVPDYSASLNTSIKGLRIGVPKEYFSAGLDPRIADLVQNSIKELEKLGAVIKEISLPNNQ
HAIPAYYVIAPAEASSNLSRFDGVRFGYRCENPKDLTDLYKRSRGEGFGSEVQRRIMVGA
YALSAGYYDAYYLKAQKIRRLIKNDFMAAFEEVDVILGPTTPNPAWKIGAKTGDPIAEYL
EDLYTITANLAGLPGLSMPAGFVDGLPVGVQLLAPYFQEGRLLNVAHQYQLHTDWHTRTP
TGF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcatcacatgactctggccgagatcgcccgcggtctcgccgacaaaacgttttcttcc
gaagaactgacccagaccctgctggcgcgtatcgccgagcacgatcccaaggtcaacagc
ttcatcagcctcaccgaggagctggcattgagccaggccaaggccgccgacgcccgtcgc
gccaacggtgaaaatggcgcgctgctgggcgcaccgatcgcccacaaggacctgttctgc
acccagggcattcgcaccagttgcggctcgaagatgctcgacaatttcaaggcaccctat
gatgccaccgtagtgtccaagctggccgctgccggggccgtgaccctgggcaagaccaac
atggacgagttcgccatgggctcggccaacgagtcgagctactacggcgcggtgaaaaac
ccgtggaacctggaacacgtgccgggtggctcgtccggtggttcggccgctgccgttgcc
gcgcgcttcctcccggctgccaccgctaccgacaccggtggctcgatccgccagccggcg
gccttcaccaacctcaccggcctgaagccgacctacggtcgcgtttcccgctggggcatg
atcgcctacgcttccagcctggatcagggcggcccgttggcacgcactgccgaagactgc
gcgatattgttacaaggcatggcaggcttcgataaacaggactccaccagtatcgatgag
ccggtgccggactacagcgcgagcctgaacacctcgatcaagggcctgcgcattggcgtg
ccaaaagagtatttcagcgccggcctcgacccgcgtatcgccgacctggtgcaaaacagc
atcaaggagctggaaaagctcggcgccgtcatcaaggaaatcagcctgccgaacaaccag
cacgcgattcccgcttactacgtgatcgcgccggcagaagcttcttccaacctgtcgcgc
ttcgacggcgtgcgcttcggctaccgctgcgaaaacccgaaagacctcaccgacctgtac
aaacgctcccgtggcgaaggcttcggcagtgaagtccagcgccggatcatggtcggtgcc
tacgccctgtcggctggctactacgacgcgtactacctcaaggcgcaaaagatccgtcgc
ctgatcaagaacgacttcatggccgcctttgaagaagtcgacgtgatcctcggcccaacc
acgccaaacccggcctggaagatcggcgccaagaccggcgacccgatcgccgagtacctg
gaagacctctacaccatcaccgccaacctcgcgggcttgccgggcttgtccatgcccgcc
ggtttcgtcgatggcctgccggtcggcgtgcaattgctcgccccgtatttccaggaaggc
cgcctgctcaatgtggcgcaccagtaccagttgcacaccgactggcacacccgcacccct
accggcttctga

DBGET integrated database retrieval system