KEGG   Pseudomonas synxantha LBUM223: VO64_4440Help
Entry
VO64_4440         CDS       T03769                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pfb  Pseudomonas synxantha LBUM223
Pathway
pfb00061  Fatty acid biosynthesis
pfb00780  Biotin metabolism
pfb01100  Metabolic pathways
pfb01212  Fatty acid metabolism
Module
pfb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pfb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    VO64_4440
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    VO64_4440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pfb01004]
    VO64_4440
Enzymes [BR:pfb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     VO64_4440
Lipid biosynthesis proteins [BR:pfb01004]
 Fatty acid synthase
  Component type
   VO64_4440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT 4HBT_2 MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AKA84986
UniProt: A0A0R2ZEB5
LinkDB All DBs
Position
4972545..4972985
Genome map
AA seq 146 aa AA seqDB search
MMDINEIREYLPHRYPFLLVDRVVDLNVEEKRIRAYKNVSINEPFFNGHFPAHPIMPGVL
IIEAMAQAAGILGFKMLDLKPADGTLYYFVGSDKLRFRSPVTPGDQLILEAKFISCKRQI
WKFECQASVDGKPVCSAEIICAERKL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatggacatcaacgagattcgcgaatacctgcctcaccgttacccgttcctgctggtg
gatcgtgtagtggacctcaacgtcgaggaaaagcgcattcgtgcctacaagaatgtcagc
atcaacgaaccattcttcaacggtcactttcctgcgcatccaatcatgccgggtgtgttg
atcatcgaggcgatggcccaggctgccggtatccttggttttaaaatgctcgacctcaag
cctgccgatggcacgctttactatttcgtgggttccgacaaactgcgttttcgcagcccg
gtcactccgggtgaccagttgatcctggaagccaagttcatcagctgcaagcgccagatc
tggaagttcgaatgccaggcctcggtcgatggcaagccagtgtgctctgccgagatcatc
tgtgcggaacgcaaactatga

DBGET integrated database retrieval system