KEGG   Pseudomonas synxantha LBUM223: VO64_4695Help
Entry
VO64_4695         CDS       T03769                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pfb  Pseudomonas synxantha LBUM223
Pathway
pfb00071  Fatty acid degradation
pfb00280  Valine, leucine and isoleucine degradation
pfb00281  Geraniol degradation
pfb00310  Lysine degradation
pfb00362  Benzoate degradation
pfb00380  Tryptophan metabolism
pfb00410  beta-Alanine metabolism
pfb00640  Propanoate metabolism
pfb00650  Butanoate metabolism
pfb00903  Limonene and pinene degradation
pfb00930  Caprolactam degradation
pfb01100  Metabolic pathways
pfb01110  Biosynthesis of secondary metabolites
pfb01120  Microbial metabolism in diverse environments
pfb01130  Biosynthesis of antibiotics
pfb01200  Carbon metabolism
pfb01212  Fatty acid metabolism
Module
pfb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pfb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    VO64_4695
   00650 Butanoate metabolism
    VO64_4695
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VO64_4695
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VO64_4695
   00310 Lysine degradation
    VO64_4695
   00380 Tryptophan metabolism
    VO64_4695
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VO64_4695
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VO64_4695
   00281 Geraniol degradation
    VO64_4695
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VO64_4695
   00930 Caprolactam degradation
    VO64_4695
Enzymes [BR:pfb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VO64_4695
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VO64_4695
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VO64_4695
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     VO64_4695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AKA85241
UniProt: A0A0E3H007
LinkDB All DBs
Position
5243264..5245411
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDTIKADASVKGVIVSS
GKDVFIVGADITEFVDNFKLPDAELVAGNLEANKIFSDFEDLNVPTVAAINGIALGGGLE
MCLAADFRVMSATAKIGLPEVKLGIYPGFGGTVRLPRLIGADNAIEWIAAGKENKAEDAL
KVGAVDAVVAPDKLAEAALNLIKGAISGEFDYKAKRQPKLEKLKLNAIEQMMSFETAKGF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFVKLAKTSAAQSLIGLFLNDQEL
KKKAKAYDEIAKDVKQAAVLGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAAKL
LVGRVDKGRMTAAKMAEVLNGIRPTLSYGDFGHVDLVVEAVVENPKVKQAVLAEVEAQVK
DDTILASNTSTISISLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSELAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAIDALYEAKRLGQKNGKGFYAYEADKKGKQ
KKVADPSVHEVLAPVIYEQREVSDEDIINWMMIALCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADKYADLGPLYHPTAKLREMAKNGQSFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtggcatcgtcgaactc
aaattcgacctcaagggtgagtccgtcaacaagttcaaccgtctaaccctgaacgaactg
cgtcaggccgtagacaccatcaaagcagatgcttcggtcaagggcgtgatcgtctccagc
ggcaaggacgtgtttatcgtcggcgctgacatcaccgaattcgtcgacaacttcaagctg
cccgatgccgagctggtggctggcaacctcgaagccaacaagatcttcagcgatttcgaa
gacctcaacgtgccgaccgttgccgcgatcaatggcatcgcgctgggcggcggccttgaa
atgtgcctggcggcggatttccgcgtcatgtccgccaccgccaagatcggcctgccggaa
gtcaaactgggcatctacccaggttttggcggcaccgtgcgcctgccgcgcctgatcggt
gctgacaatgctatcgagtggatcgccgccggtaaggaaaacaaggccgaagacgccctg
aaagtcggtgctgtcgacgctgttgttgccccggacaaactggccgaagctgcgctgaac
ctgatcaagggcgccatcagcggcgaatttgactacaaggccaagcgtcagccaaagctg
gaaaaactcaagctcaacgccatcgaacaaatgatgtcgttcgaaaccgccaagggtttc
gtggctggccaggccggcccgaactacccggcgccggttgaagcgatcaagactatccag
aaggccgcgaacttcggtcgcgacaaggcccttgaagtggaagcggccggcttcgtcaag
ctggcgaagacctcggcggcccagagcctgatcggcttgttcctgaacgatcaggaactg
aagaaaaaggccaaggcctacgacgaaatcgccaaggacgtgaagcaggctgccgtactc
ggcgccggtatcatgggtggcggcatcgcctatcagtcggcgtccaagggcacgccgatc
ctgatgaaagacatcaacgaacacggtatcgagcagggcctggccgaagccgccaagctg
ctggttggccgtgttgataaaggtcgcatgaccgcggcgaaaatggccgaggtgcttaat
ggcattcgtcctacgctatcttacggcgatttcggccacgtcgacctggtggtcgaagcg
gttgtcgagaacccgaaggtcaagcaggccgtgttggctgaagttgaagcccaggtcaag
gacgacaccatcctggcgtccaacacctcaaccatttccatctcgctgctggccaaggcc
ctcaagcggccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtgatccgtggcgagaaatccagcgagctggcggttgccaccaccgttgcc
tacgccaagaaaatgggcaagaacccgatcgtggtcaatgactgcccgggcttcctggtc
aaccgcgtactattcccctacttcggcggtttcgccaagctggtcagcgccggtgtggac
ttcgtgcgcatcgacaaggtcatggaaaaattcggctggccaatgggcccggcgtacctg
atggacgtggtcggtatcgacaccggccaccacggtcgcgacgtgatggctgagggcttc
ccggaccgcatgaaagacgaccgccgctcggcgatcgatgcgctgtacgaggccaagcgc
ctgggtcagaagaatggcaagggtttctacgcctacgaggccgacaagaagggcaagcag
aagaaagtggccgacccgtcggtgcatgaagtgctggctccggttatctacgaacagcgt
gaggtgtccgacgaggacatcatcaactggatgatgatcgccctgtgcctggaaaccgtg
cgttgcctggaagacggcattgtcgagaccgccgccgaagccgatatgggcctggtgtac
ggtatcggtttccctccattccgtggtggtgcgctgcgttacatcgattcgatcggtgtg
gctgagttcgttgccctggctgacaaatacgctgatttgggcccgctgtaccacccgacc
gcgaagctgcgtgaaatggccaagaacggccagagcttcttcggttaa

DBGET integrated database retrieval system