KEGG   Pseudomonas synxantha LBUM223: VO64_5549Help
Entry
VO64_5549         CDS       T03769                                 

Definition
(GenBank) L-arabinose-specific 1-epimerase (mutarotase)
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pfb  Pseudomonas synxantha LBUM223
Pathway
pfb00010  Glycolysis / Gluconeogenesis
pfb00052  Galactose metabolism
pfb01100  Metabolic pathways
pfb01110  Biosynthesis of secondary metabolites
pfb01120  Microbial metabolism in diverse environments
pfb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VO64_5549
   00052 Galactose metabolism
    VO64_5549
Enzymes [BR:pfb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     VO64_5549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AKA86095
UniProt: A0A0E3KHV0
LinkDB All DBs
Position
complement(6220549..6221697)
Genome map
AA seq 382 aa AA seqDB search
MKHPRYLLSGLALSMLVASGGTQAAGLTSEHKPFGKTNDGTAVEQYILRNSHGMQATVIT
YGGVLQSLKVPDKHGKVDDVVLGFDDVQGYQAGTAFFGATIGRFGNRLAGGAFELDGKRY
QVPLNDGPNSLHGGAQGFDKQVWQAQPVKDKDSVGVTLTYLSKDGEMGFPGNLKTEVTYR
LNDNNELHIDYKATTDKPTVLNLTNHSYFNLAGAGNGDILKQVATLHASHYTPVNATLIP
TGELAPVKDTPMDFLKPTPIGQHIKADHPQLKFAEPKQGGFDFNWALDTKGDIKQLAADV
HDPESGRRLQLYTSEPGVQFYTSNFLDGSVKGKGGKTYQHWSGFTLETQHFPDAPNQPGF
ASTRLNPGQTYTQHTLFKFSAD
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccctcgttacctgctgtccggtctggcgctgtccatgctggtcgccagcggc
ggcacccaggccgccggcctgaccagcgaacacaaacccttcggcaaaaccaatgacggc
accgccgtcgaacagtacatattgcgcaacagccatggcatgcaagccacggtgatcacc
tacggcggcgtattgcagtcgttgaaggtgccggacaaacacggcaaggtcgacgacgtg
gtgctgggtttcgatgacgtgcagggctatcaggccggcacggcattttttggcgcgacc
atcggccgtttcggcaatcgcctggccggcggcgccttcgaactcgacggcaaacgctac
caggtgccgctcaacgacggtcccaactccctgcatggcggcgcccaaggcttcgacaag
caggtatggcaagcccagccggtcaaggacaaggactcggtgggcgtcaccctcacctac
ctgtccaaggacggtgaaatgggcttccccggtaacctgaagaccgaagtcacttaccgc
ctgaacgacaacaacgaactgcacatcgactacaaggccaccaccgacaaaccgacggtg
ctcaacctgaccaaccacagctacttcaacctcgccggcgcgggtaacggcgacattctc
aagcaggtcgccaccctgcatgccagccactacacccccgtgaatgccaccttgatcccc
accggtgaactggcgcccgtcaaggacacgccaatggacttcctcaagcccacgcctatc
ggccagcacatcaaggcggaccatccgcagctcaagttcgccgaaccgaaacagggtggg
ttcgacttcaactgggcgctggataccaagggtgacatcaagcagctcgccgcggacgtg
catgaccctgagtccggccggcgcttgcagctctacaccagcgaaccgggtgtgcagttc
tataccagcaacttcctcgatggttcggtgaagggcaaagggggcaagacgtatcagcac
tggagcgggtttaccttggaaacccagcacttcccggatgcgcctaaccagccaggcttt
gcctcaactcgcttgaaccctgggcagacctatacccaacacaccctcttcaagttctcc
gccgattaa

DBGET integrated database retrieval system