KEGG   Pseudomonas fluorescens A506: PflA506_0932Help
Entry
PflA506_0932      CDS       T02114                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00473  D-Alanine metabolism
pfc00550  Peptidoglycan biosynthesis
pfc01100  Metabolic pathways
pfc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pfc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PflA506_0932 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PflA506_0932 (ddlB)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    PflA506_0932 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pfc01011]
    PflA506_0932 (ddlB)
Enzymes [BR:pfc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PflA506_0932 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:pfc01011]
 Precursor biosynthesis
  Amino acid ligase
   PflA506_0932 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_Ter RimK ATP-grasp_5 ATPgrasp_YheCD TTL GARS_A
Motif
Other DBs
NCBI-ProteinID: AFJ59694
LinkDB All DBs
Position
1054401..1055357
Genome map
AA seq 318 aa AA seqDB search
MTTDYGSLFSTLAPADFGRVAVLFGGKSAEREVSLKSGNAVLEALQSAGVNAFGIDVGDD
FLARLQAEKIDRAFLILHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHAVLCSEDDCISAAKELGLPLIVKPAHEGSSIGMAKVNSAAELIDAWKAAST
YDSQVLVEQWISGPEYTIATLRGQVLPPIALGTPHTFYDYDAKYLASDTQYRIPCGLEAT
KEQELMDLTAKACEALGIAGWARADVMQDDQGNFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILADSIEPRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgattacggctccctgttttccacccttgcgcctgccgacttcggtcgcgtg
gccgtgttgttcggcggcaagagcgccgagcgcgaagtgtcgctcaagtccggcaatgcg
gtgcttgaggcgctgcaaagtgctggcgtgaatgccttcggtatcgatgtgggcgatgac
ttccttgcccgtctgcaggctgaaaaaatcgaccgcgcctttctcattcttcacggccgc
ggcggtgaggacggcagcatgcagggcctgctcgaatgcgccggcatcccttacaccggc
agcggcatcctcgcatcggccttggcgatggacaagttgcgcaccaagcaggtgtggcac
agcctgggtattccgaccccacgtcacgccgtactgtgcagtgaagacgattgtatttct
gcggccaaggaactgggcctgcctttgatcgtcaaaccagcccatgaaggctccagtatc
ggcatggccaaagtgaactcggccgccgaattgatcgacgcatggaaagcggcaagtacc
tacgattcgcaagtgttggtggaacagtggatttccggtcccgagtacaccatcgccacc
ctgcgtggccaggtattgccgcccatcgctttgggcacgccccacaccttttatgactac
gacgccaagtacctggcttccgatactcagtaccggatcccatgcggcctcgaagcaacc
aaggaacaagaattgatggacctcacggcgaaagcctgtgaggcgctgggtatcgccggt
tgggcgcgggcagacgtgatgcaggatgaccaagggaatttctggttccttgaagtcaac
accgcaccgggcatgaccgaccacagcctggttcccatggcagcccgtgccgccggtctg
gatttccagcagttagtgctggcgatcctggccgacagcattgagccaagaggctaa

DBGET integrated database retrieval system