KEGG   Pseudomonas fluorescens A506: PflA506_2794Help
Entry
PflA506_2794      CDS       T02114                                 

Gene name
pstB2
Definition
(GenBank) phosphate ABC transporter, ATP-binding protein PstB2
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pfc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PflA506_2794 (pstB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfc02000]
    PflA506_2794 (pstB2)
Enzymes [BR:pfc01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     PflA506_2794 (pstB2)
Transporters [BR:pfc02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    PflA506_2794 (pstB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_23 AAA_22 AAA_29 Rad17 RsgA_GTPase NB-ARC AAA_16 AAA_18 G-alpha AAA_33 AAA_30 AAA_28
Motif
Other DBs
NCBI-ProteinID: AFJ57723
LinkDB All DBs
Position
complement(3107647..3108465)
Genome map
AA seq 272 aa AA seqDB search
MNVSTAQIAAPFVTQSPVVMDCKLDRIFYGNFMAVRDSHVPIEKNKITGFIGPSGCGKST
VLRSLNRMNDLVKGFRFEGHVHFLGQDVYGKGVDPVVVRRYIGMVFQQPNPFSMSIFDNV
AFGLRLNRYKGDLGDRVKHALQGAALWDEVKDKLKVSGLSLSGGQQQRLCIARAIATEPE
VLLLDEPCSALDPIATRRVEELMVELKKDYTIALVTHNMQQAIRVADTTAFFSVDISQGT
RTGYLVEMGPTAQIFGSPREQMTEDYISGKFS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgtctcaactgcgcaaatagccgctccgtttgtcacccaatcgcctgtggtcatg
gactgcaagctggaccggattttctacggcaacttcatggcggtgcgtgacagccatgtg
ccgatcgagaaaaacaagatcaccggttttatcggcccgtccggctgcggcaaaagtaca
gtactgcgcagcctcaaccgcatgaacgacctggtgaagggttttcgtttcgaaggccac
gtgcatttcctggggcaggacgtgtatggcaagggtgtagacccggtggtggtgcgccgt
tacatcggcatggtgtttcaacagcctaacccgttctccatgagcatcttcgacaacgtt
gccttcggcctgcgcctgaaccgctacaaaggcgacttgggcgatcgcgtcaaacacgcc
ctgcaaggcgctgcgctgtgggacgaagtcaaggacaagctcaaggtcagcggcctgtcg
ctctccggcggccagcagcaacggctgtgtattgcccgcgctatcgccaccgagccggaa
gtgctgttgctcgatgagccgtgctcggcactcgacccgattgcgactcgccgggtagag
gagctgatggtggaactgaagaaggattacaccatcgccctggtcacccacaacatgcag
caggccattcgcgtggcggacaccacggcgtttttctcggtggatatttcccagggcacg
cgtaccggctacctggtggaaatgggcccgaccgcgcagatttttggcagcccgcgtgaa
cagatgaccgaggattacatcagtggcaagttcagctga

DBGET integrated database retrieval system