KEGG   Pseudomonas fluorescens A506: PflA506_4164Help
Entry
PflA506_4164      CDS       T02114                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pfc  Pseudomonas fluorescens A506
Brite
Enzymes [BR:pfc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PflA506_4164 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFJ59350
LinkDB All DBs
Position
4590028..4590624
Genome map
AA seq 198 aa AA seqDB search
MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS
SGGIFNNAAQVWNHTFYWNCLAPNAGGQPTGALAEAINAAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGNPLTNGDTPLLTCDVWEHAYYIDYRNVRPKYVEAFWN
LVNWKFVAEQFEGKAFTA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgccgctgccctacgcacacgatgccctgcagccgcacatctcc
aaggaaaccttggagtaccaccacgacaagcaccacaacacctatgtcgtgaacctgaac
aacctggtgcccggcaccgagttcgaaggcaagaccctggaagagatcgtcaagtcttcc
tcgggcggtatcttcaacaacgccgctcaggtctggaaccacaccttctactggaactgc
ctggcgccaaacgccggcggtcaaccaaccggcgcgctggctgaagccatcaacgctgcg
ttcggttcgttcgacaagttcaaggaagagttcaccaagacttcggttggcaccttcggt
tccggttggggctggctggtgaaaaaggctgacggttccctggccctggccagcaccatc
ggcgccggcaacccgctgaccaacggcgacaccccgctgctgacctgcgacgtgtgggaa
cacgcctactacatcgactaccgcaacgtgcgtccaaagtatgtggaagcgttctggaac
ctggtcaactggaagttcgtggctgagcagttcgaaggcaaggccttcactgcctaa

DBGET integrated database retrieval system