KEGG   Pseudomonas fluorescens A506: PflA506_4487Help
Entry
PflA506_4487      CDS       T02114                                 

Gene name
antA
Definition
(GenBank) anthranilate 1,2-dioxygenase, large subunit
  KO
K05599  anthranilate 1,2-dioxygenase (deaminating, decarboxylating) large subunit [EC:1.14.12.1]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00627  Aminobenzoate degradation
pfc01100  Metabolic pathways
pfc01120  Microbial metabolism in diverse environments
Module
pfc_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:pfc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PflA506_4487 (antA)
Enzymes [BR:pfc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     PflA506_4487 (antA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Ring_hydroxyl_A
Motif
Other DBs
NCBI-ProteinID: AFJ58955
LinkDB All DBs
Position
4939645..4941036
Genome map
AA seq 463 aa AA seqDB search
MSGARTVEQWKSFIESCLDFRPADEVFRIARDMFTEPELFDLEMELIFEKNWIYACHESE
LAHNHDFVTMRAGRQPMIITRDGEGRLNALINACQHRGTTLTRVGKGNQSTFTCPFHAWC
YKSDGRLVKVKAPGEYPEGFDKATRGLKKARIDSYKGFVFISLDVNGTDSLEDFLGDAKV
FFDMMVAQSATGELEVLPGKSAYTYDGNWKLQNENGLDGYHVSTVHYNYVATVQHRQQVN
TENGAGSSTTLDYSKLGAGDANTDDGWFAFNNGHSVLFSDMPNPSVRSGYATIMPRLVEE
HGQQKAEWMMHRLRNLNIYPSLFFLDQISSQLRIIRPVAWNKTEIISQCLGVKGESDADR
ENRIRQFEDFFNVSGMGTPDDLVEFREAQRGFQGRLERWSDISRGSHRWETGPTPNSEAI
GIQPAMTGTEFTHEGLYVNQHRNWQQFLLQGLERQALTLREVK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtgcaagaaccgtcgagcagtggaaatcctttatcgaaagttgcctggacttt
cgcccggcggatgaagtgttccgcatcgcccgcgacatgttcaccgagcccgagctgttc
gacctggagatggaactgatcttcgagaagaactggatctacgcctgccacgaaagcgaa
ctggcccataaccacgacttcgtgacgatgcgcgccgggcgccagccgatgatcatcacc
cgcgacggcgaaggccggctcaacgcgctgatcaatgcctgccagcatcgcggcactacc
ctcacccgcgtgggcaagggcaatcaatccacgttcacctgcccgttccacgcctggtgc
tacaagagcgatggccgactggtgaaggtcaaggcgccgggggaatacccggaaggtttc
gacaaggccacccgcggcctgaaaaaagcgcgcatcgacagctacaagggctttgtgttt
atcagcctggacgtgaacggcaccgacagcctggaagatttcctcggcgacgccaaagtg
ttcttcgacatgatggtggcgcaatcggccaccggagagttggaggtgctgccgggcaag
tccgcctacacctatgacggcaactggaagctgcaaaacgaaaacggcctggacggttat
cacgtcagcaccgtgcactacaactacgtggccaccgtgcagcatcgccagcaggtcaac
accgagaacggcgcaggttccagcacgacgctggactacagcaagctcggcgccggcgac
gcaaataccgacgacggctggttcgccttcaacaatggccacagcgtgttgttcagcgac
atgcccaaccccagcgtacgctccggctacgccaccatcatgccgcgtctggtagaagaa
cacggccagcagaaggccgagtggatgatgcaccgcctgcgcaacctgaatatctacccc
agcctgttctttctcgaccagatcagctcgcagttgcgcatcatccgcccggtggcctgg
aacaagaccgagatcatcagccagtgcctgggggtcaagggtgagtccgacgccgaccgc
gaaaaccggattcgccagttcgaggacttcttcaacgtttcgggcatgggcacgcccgat
gacctggtggagtttcgcgaagcccagcgcggtttccagggccgcctggagcgctggagc
gatatctcacgaggcagccatcgctgggagactgggccgacgcccaacagcgaagccatt
ggcatccaaccagccatgaccggcaccgagttcacccacgaaggtttgtacgtcaaccag
catcgcaactggcagcagttcctgctccagggcctggagcgacaagcgctgacactgcgg
gaggtgaagtga

DBGET integrated database retrieval system