KEGG   Pseudomonas fluorescens A506: PflA506_5296
Entry
PflA506_5296      CDS       T02114                                 

Gene name
tssL1
Definition
(GenBank) type VI secretion protein TssL1
  KO
K11892  type VI secretion system protein ImpK
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pfc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PflA506_5296 (tssL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfc02044]
    PflA506_5296 (tssL1)
Secretion system [BR:pfc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PflA506_5296 (tssL1)
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: AFJ55933
LinkDB
Position
complement(5797682..5798971)
AA seq 429 aa
MHPNDDDRTQFMPRPGGREPAPARAEPAPLSMPAAPILTGKSQGLNPLESAAGPLLALLT
RLRNTIAHPAPASLRAQLLAYLRQFEERAEAAGVARNEVLLARYALCTALDEAVLSTPWG
STSDWGKQSLLITVHNEAWGGEKVFQLLDHCLQSPRERLYLLELLYLCMCLGFEGRYRVM
TDGRSQLEALRERTAAAIRSARGEHERELSPHWRGVTVARDRLAQFMPPWIAVAIGLALL
LALLFGLRLKLASDAEPVFKNIHALGEIPVQAIDRPVAQPKVIERPRLAGFLADDIKAGR
VAVEDKVDRSVVTIRGDELFASASSSIVDDYQPLMLRIADAIRKVKGQVRVTGHSDNRPI
ATLRFPSNWALSEARAKSVLAILAAKTGQAERFSAEGRSDTEPLATNSTAEGRARNRRVE
ITVLAEGVE
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgcatcccaatgatgatgaccgcacccagttcatgccgcgcccgggtggccgagaacct
gcacccgcgcgtgccgaacctgcgccgctgtcgatgccggctgcgccgatcctcaccggc
aagagccagggcctcaacccgctggaaagtgccgccggcccgttgctggcgttgttgacg
cggttgcgcaacaccatcgcccatcccgcgccggccagcctgcgtgcgcagttgctggcg
tacctgcgccagttcgaagagcgcgccgaagccgccggtgtggcacgcaatgaagtgctg
ttggcccgttacgcgctgtgcactgccttggatgaggcggtgctgagcacgccgtggggc
agcaccagtgactggggtaagcagagcctgctgatcaccgtgcacaacgaagcctggggt
ggtgaaaaggttttccagttgcttgaccactgtctgcaaagcccacgggaacgcctgtac
ctgctggagctgttgtacctgtgcatgtgcctgggttttgaagggcgttaccgcgtgatg
accgacgggcgcagccagttggaagccttgcgtgaacgcaccgccgcagcgatacgcagc
gcccgtggcgagcacgagcgtgagctgtcgccgcactggcgcggtgtaaccgtggcccgt
gatcgcctggcgcaattcatgccgccatggattgccgtggcgattggcttggcgctgctg
ttggcgttgctgttcggcctgcgcctgaagctggcctcggacgccgagccggtgttcaag
aatattcatgccctgggcgagatcccggtgcaggccatcgaccgtccggtggcgcagccc
aaagtgattgagcgcccgcgcctggccgggttcctggccgacgacatcaaggccggccgc
gtggcggtggaagacaaggtcgaccgctctgtcgtgaccattcgtggcgatgagctgttc
gcctcggccagctccagcatcgtcgatgactaccagccgctgatgctgcgcatcgctgac
gccattcgcaaggtcaagggccaggtgcgtgtcaccgggcacagcgacaaccgcccgatt
gccacgttgcgtttcccgtccaactgggcgttgtccgaagcccgggccaagtcggtgctg
gcgattctcgcggccaagaccggccaggccgaacgcttcagcgccgaaggccgcagcgac
accgagccgttggccaccaacagtactgccgaaggccgtgcccgcaatcgtcgggttgaa
atcaccgtattggcggagggcgtcgagtga

DBGET integrated database retrieval system