KEGG   Plasmodium falciparum Dd2: PFDG_02621Help
Entry
PFDG_02621        CDS       T01051                                 

Definition
(Broad) succinate dehydrogenase flavoprotein subunit, mitochondrial precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
pfd00020  Citrate cycle (TCA cycle)
pfd00190  Oxidative phosphorylation
pfd01100  Metabolic pathways
pfd01110  Biosynthesis of secondary metabolites
pfd01130  Biosynthesis of antibiotics
pfd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFDG_02621
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PFDG_02621
Enzymes [BR:pfd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PFDG_02621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 DAO Lycopene_cycl GIDA FAD_binding_3 HI0933_like NAD_binding_8
Motif
LinkDB All DBs
AA seq 631 aa AA seqDB search
MIRNNKKYIRFMQSSFCRFSNIKTKAYDIIDHHYDAVIVGAGGAGLRSALELSKNKYKVA
CISKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTIKGSDWLGDQNAIHYMCREAPD
SVLELEEFGLPFSRTKDGKIYQRAFGGQSLKYGKGGQAYRCAAAADRTGHAMLHTLYGQS
LSYNCIFFVEYFVLDLLMLNSNECIGVICINIADGKIHRFFTPHTVIATGGYGRAYLSCT
SAHACTGDGNAIVARSKLPLQDLEFVQFHPTGIYPAGCLITEGCRGEGGILRNKEGEAFM
MRYAPKAKDLASRDVVSRAMTIEINEQRGCGPNADHIYLDLTHLPYETLKERLPGIMETA
KIFAGVDVTKQYIPVLPTVHYNMGGIPTNYKTQVLTQNVNFNKQTNKSNEDIIVKGLYAA
GEAASASVHGANRLGANSLLDIVVFGKRAALTIMEIDKPNIPKINANTNIGEESIQRLDH
IRFNKGSIQTSQLRKKMQICMQKHAAVFRIGPLLQEGYKQILEICSIFKDIEITDKTLTW
NTDLLETLELENLLTLASQTILAAVERKESRGAHARDDFPERDDKNYLKHSLTWMTDRNI
ENTKYFTTYRDVITKPLDNEMEYVPPVKRVY
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgattaggaataataaaaaatacataagatttatgcaatcaagtttttgtagattctca
aatattaaaacgaaagcatatgatataattgatcatcattatgatgcagtaattgtagga
gctggaggtgctggattaagatctgcattggaattatcaaaaaataaatacaaggtagca
tgtatcagtaaattgtttccaacacgatcacatactgtagctgctcaaggtggaataaat
gcagctttaggtaatatgactgaagatgattggagatggcatgcttatgatactatcaaa
ggttcagattggcttggggatcaaaacgctattcattatatgtgtagagaagctcctgat
tctgtattagaattagaagaatttggactcccgttttcaagaacaaaagatgggaaaata
tatcaaagagcttttggaggacaaagtttaaaatatggtaaaggaggacaagcttataga
tgtgctgccgctgctgatagaacaggacatgccatgttacatacattatatggacaatcc
ttatcttacaattgtatattttttgtagaatattttgttttagatttacttatgttaaat
tctaatgaatgtattggggtaatctgtattaatatagcagatggaaaaatacatagattt
tttacaccacatactgttatagctactgggggatatggtcgagcttatttgtcttgtaca
tctgctcatgcatgtacaggagatggtaatgccattgtagctagaagtaaattaccatta
caagatttagaatttgtacaatttcatccaacaggtatatacccagctggatgcttaatt
actgaaggatgtagaggagaaggtggtattttaagaaataaagaaggagaagcctttatg
atgagatatgcacctaaagcaaaagatttagctagtcgtgatgttgttagtagagctatg
accatagaaattaatgaacaaagaggatgtggaccaaacgcagatcatatatatttagat
ttaacacatttaccatatgaaacattaaaagaaagattaccaggcataatggaaactgca
aaaatttttgcgggagttgatgtaactaaacaatatattcctgtcttaccaacagttcat
tataatatgggtggaattccaactaattataaaacacaagtgttaacacaaaacgtaaat
tttaataaacaaactaataaatcaaatgaagatattattgtaaaaggcctttatgctgca
ggagaagctgcatcagcatctgttcatggagcaaatcggttaggagctaattcactttta
gatattgtcgtttttggtaaaagagctgcactaactattatggagatagataaaccaaat
attcctaaaataaatgcaaatactaatataggtgaagaatctatacaaagattagatcat
ataagatttaataaaggtagtatacaaacatcgcaattaagaaaaaaaatgcaaatatgc
atgcaaaaacatgctgctgtttttagaattggaccgttattacaagaaggttataaacaa
attcttgaaatatgttccatttttaaagacatagaaattactgataaaacgttaacatgg
aatacagatttattagaaacattagaacttgaaaatttactaacactcgcatcacaaact
atcttagcagctgttgaaagaaaagaatcaagaggtgctcatgctcgtgacgatttccct
gaaagagatgataaaaactatttaaaacattccttaacatggatgactgacagaaatatt
gagaatacaaaatattttacgacttacagggatgttataacaaaaccattagataatgaa
atggaatatgttccacctgttaaacgtgtttattaa

DBGET integrated database retrieval system