KEGG   Plasmodium falciparum Dd2: PFDG_02775Help
Entry
PFDG_02775        CDS       T01051                                 

Definition
(Broad) hypothetical protein
Organism
pfd  Plasmodium falciparum Dd2
SSDB OrthologParalogGFIT
Motif
Pfam: Spindle_Spc25 MIF PGM_PMM_II
Motif
LinkDB All DBs
AA seq 147 aa AA seqDB search
EEEKKLEEYPKLISEINNKLNLILKNFDSSKLEYNTVKLHKDYIQGEWKKKLETLYKLLG
FEIILEDDKIVIEFSNIQDSEPQKKYRATLVLKNGIYEGNTYKNLLSFLIETNPRINKFE
DFVDSLNKGLPFTTFCCLLRRSFKELK
NT seq 658 nt NT seq  +upstreamnt  +downstreamnt
gaggaggaaaaaaaattagaggaatatcccaaattaatttctgagattaataataaatta
aatttaattttaaaaaattttgattcgtccaaattgggtacataccatatatatatatat
atatatttatttatttatttatttatttgtttctttattttatttttattttagaatata
atacagttaaattacacaaggattatattcaaggagaatggaagaaaaaactagaaacct
tgtataagcttttagggtttgaaataatattagaaggtgaggatttataaattatgtaca
tatatttatatatatatatatatatatatttatttatttatttaaaaattcagatgataa
aatagttatagagttttcaaatattcaagattctgaaccacaaaagaaatatcgagcaac
tcttgttttgaaaaatgggatatatgaaggtaacacatataaaaatcttttgtccttttg
ttatatgacatatatatataattaaaattatgttaatatatatatatatttttatatagt
aattgaaacgaacccacgtattaataaatttgaagattttgtcgacagtttaaataaagg
attacccttcactactttttgttgtctactcagacgatcatttaaagaattaaaataa

DBGET integrated database retrieval system