KEGG   Plasmodium falciparum Dd2: PFDG_03413Help
Entry
PFDG_03413        CDS       T01051                                 

Definition
(Broad) hypothetical protein similar to FAD-dependent glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
pfd00564  Glycerophospholipid metabolism
pfd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PFDG_03413
Enzymes [BR:pfd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     PFDG_03413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 HI0933_like Pyr_redox_3 Pet20 Reovirus_L2 Menin
Motif
LinkDB All DBs
AA seq 515 aa AA seqDB search
MIKKVAICSGTLGILSYGGFYFLKINFQKNMIDKDVTYKYSPCIKRNEMFKKLQENQYDL
LIIGGGATGAGLALDAATRGLKCALVEKNDFSSGTSSKSTKLLHGGIRYLENAVNNLDFT
ELYFVWEALAERAHTMKIAPYLSRPVSILMPIYKYWQVPYFSYNIKIYDLLADLVCYFDK
GVPNSLYIRKSNTIDNFPLLRKDKLKGSLIYFDGQHDDSRMNLNLILTSAIDNYVPGQIG
ATVCNHMEVKNFIKDENNKLVGVRAIDKINDKEIEIFSKVIINATGPYGDIIRKLADENR
KPMIQVSVGCHFILPKWYSTKNNGMIIPKTSDDRVLFLLPWENNTLVGTTDEKRIMQDDP
KIQEKDIEFLTNELSKYIHVSAEEIKNDITAAWCGFRPLISTNNNKKSKFSSNKKKNNNN
NINSNSSSNSNNFDDEQNNNNNNIGTHEISRSHEIIEDDNGLISILGGKWTIYRKMAQDT
LDYILRKYPNELKTKYNCRTKFLKLIGCHDKYGYL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagttgctatttgtagtgggaccttgggtattttatcctatggagggttt
tattttttaaaaataaattttcaaaagaatatgatagataaagatgtgacatataaatat
agtccttgtataaaaagaaacgaaatgtttaagaagctacaagaaaatcaatatgattta
ttaataataggaggaggtgctacaggtgctggtttggccttagatgcagccacaagagga
ttaaaatgtgcgctagtagaaaagaatgatttttcaagtggtacatcttctaagtctacc
aaattattacatggtggtataagatatttagaaaatgcagtaaataatttagattttaca
gaattatattttgtatgggaagcattagcagaaagagcgcacacaatgaaaatagcacca
tatttatcaagaccagtatctattttaatgcctatatataaatattggcaagtaccttat
ttttcttataatattaagatatatgatttattagctgatctggtttgttattttgataaa
ggtgtacctaattctttatatattagaaaatcgaatactatcgataatttcccattatta
agaaaagataaattgaaaggatctttaatttattttgatgggcaacacgatgatagtaga
atgaatttaaatttaatattgactagtgctattgataattatgtacctggacaaatagga
gctactgtatgtaatcatatggaagtgaaaaattttataaaagatgaaaataataaactt
gttggtgtacgtgccatagataaaattaatgataaagaaattgaaatattttcgaaagtt
attattaatgctactggtccatatggtgatatcatacgtaaactagctgatgaaaataga
aaacccatgatacaagtttctgttggatgccatttcatattacctaaatggtactctaca
aaaaataatggaatgataataccgaaaactagtgatgatagggtacttttcttactaccc
tgggaaaataatactttagtaggtactactgatgaaaaaagaataatgcaagatgatccg
aaaatacaagaaaaggatatcgaattcttaacaaatgaactatctaaatatattcatgta
agtgcagaagaaattaaaaatgatataaccgctgcatggtgtggttttagacctctaatt
tcaacaaataataataaaaaaagcaaattttcttcaaacaaaaagaaaaataataacaac
aatattaatagtaatagtagtagtaatagtaacaattttgatgatgaacaaaataataat
aataataatataggtacacatgaaatatcaagaagtcatgaaattatagaagatgataat
ggtcttatcagtatattaggtggcaaatggactatatatagaaaaatggcacaagacacc
ttagattatattttacgtaaatatccaaatgaactaaaaacaaaatataattgtcgaact
aagtttttaaaacttataggctgtcatgataaatatgggtatctttaa

DBGET integrated database retrieval system