KEGG   Pseudomonas fluorescens F113: PSF113_0163Help
Entry
PSF113_0163       CDS       T01734                                 

Gene name
pgaC
Definition
(GenBank) PgaC
  KO
K11936  poly-beta-1,6-N-acetyl-D-glucosamine synthase [EC:2.4.1.-]
Organism
pfe  Pseudomonas fluorescens F113
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pfe01003]
    PSF113_0163 (pgaC)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfe02000]
    PSF113_0163 (pgaC)
Enzymes [BR:pfe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     PSF113_0163 (pgaC)
Glycosyltransferases [BR:pfe01003]
 Polysaccharide
  Bacterial polysaccharide
   PSF113_0163 (pgaC)
Transporters [BR:pfe02000]
 Other Transporters
  Others
   PSF113_0163 (pgaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_2 Chitin_synth_2 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: AEV60195
UniProt: G8PYA0
LinkDB All DBs
Position
178540..179895
Genome map
AA seq 451 aa AA seqDB search
MLDRLLALLVLAIVLGVPLGLIFLVTGQFLMDFVFFYPLFMSGLWIAGGLYFWLHWERHW
PWKDDTLPPPLAGEPLISILIPCFNEGDNVADTIHAALGQHYPNIEVIAINDGSKDNTAQ
MLDQLAAEDPRLRVLHLAENQGKAVALRMGAIAARSEYLVCIDGDALLAPNTCAYLVAPM
LDNARLGAVTGNPRIRTRSTLVGRVQVGEFSSIIGLIKRTQRVFGRIFTVSGVIVAFRRT
ALHRVGYWSPDMITEDIDISWKLQLDHWSIFYEPRALCWILMPETLRGLWRQRLRWAQGG
AEVLFKNIRGIWQYRHRYLWPLLFEYCLSTGWAFTFLLSVIFWGAGKFVEMPAAIAVDHL
MPPAFTGLLLAVVCLLQFAVSILIDRRYEKGLWHIMFWVVWYPLVFWLISLFTTLVSFPK
VLFGQHQKRARWVSPDRGIKPFDDQEEEVIR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacagactgctcgctctgctggtgctggcgatcgtcctcggggtgcccctgggc
ctgatcttcctggtcaccgggcaattcctgatggacttcgtgttcttttacccgctgttc
atgtccgggctgtggatcgccggcggcctgtatttctggctgcactgggaacgccactgg
ccgtggaaagacgacaccttgccaccgcccctggccggcgagccgctgatcagtatcctg
atcccgtgcttcaacgaaggcgataacgtcgccgacaccattcacgcggcgctgggccag
cattacccgaacatcgaagtcatcgcgatcaacgacggctccaaggacaacactgcccag
atgctcgatcagctggcggctgaagacccgcgcctgcgcgtcctgcacctggcagaaaac
cagggcaaggccgtggccctgcgcatgggcgccatcgcggcgcgcagcgaatacctggtg
tgcatcgacggtgacgcgctgctggcgccgaacacctgtgcttacctggtggcgccgatg
ctggacaacgcccgcctcggcgcggtgaccggcaacccgcgcatccgcacccgctcgacc
ttggtgggccgggtccaggttggcgagttctcctcgatcatcggcctgatcaagcgcact
caacgggtgttcgggcggatcttcaccgtgtctggcgtgatcgtcgcgttccgtcgcacc
gccctgcaccgggttggctactggagcccggacatgatcactgaagacatcgacatcagc
tggaagctgcaactggatcactggagcatcttctacgagccgcgcgcactgtgctggatc
ctcatgcccgaaaccctgcgcggcctgtggcggcaacggctgcgctgggcccagggtggc
gcggaagtgctgttcaagaacatccgaggcatctggcaataccgccaccgctacctgtgg
ccgctgttgttcgaatattgcctgtccaccggttgggcgttcacgttcctgctgtcggtg
attttctggggcgccggcaaattcgtcgagatgcctgcggccatcgccgtggatcacctg
atgccgccggccttcaccgggttgctgctggcggtggtgtgcctgctgcagttcgcggtg
agcatcctgatcgatcggcgctacgaaaaaggcctgtggcacatcatgttttgggtggtc
tggtatccgttggtgttttggctgatcagcctcttcaccaccctggtgagttttccaaaa
gtgctgttcgggcagcatcagaagcgtgcgcgctgggtcagtccggatcgcggtatcaaa
ccgttcgatgatcaggaagaggaagtgatccgatga

DBGET integrated database retrieval system