KEGG   Pseudomonas fluorescens F113: PSF113_2315Help
Entry
PSF113_2315       CDS       T01734                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pfe  Pseudomonas fluorescens F113
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSF113_2315
Enzymes [BR:pfe01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PSF113_2315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored DAO AlaDh_PNT_C Thi4 FAD_binding_3 NAD_binding_7 K_oxygenase NAD_binding_8 FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AEV62326
UniProt: G8QAI6
LinkDB All DBs
Position
2697235..2698797
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLQDVASLSHQITLLDNGSDAR
KPSFSLNRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVDVIEQVRALKGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVDERQIMAVPSVYLNGVNF
GQGRMGLEEILAKIDTSGIERQAEKISAKDAFDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLAVALEEHVKQYDVDIMNLQRADGLVPGKDGGL
HEIKFASGASLKAKAVILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLLEFDVQLRADAVLQRKLHSLPNVTVITNAQTTEVTGDGQ
KVNGLRYKDRPSGDVREVELEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDARGETSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagctcagttgaagtcatacctggaacgggtcacccagccg
atcgagatcgtcgcctccctcgacgacggtgcgaaatcccaggaaatgctcgcgttactc
caagacgttgccagtctttcccaccagattactttgctcgacaacggtagcgatgcgcgc
aagccttcgttttcgttgaatcgcccgggagccgatatcagcctgcgttttgccggcatt
cccatgggccacgaatttacttcgctggtgttggccttgctgcaagtcggcggtcaccct
tcgaaggccagtgtcgatgtcatcgaacaggtccgcgccctcaagggcgagttcaacttc
gagacgtatttctcgctgtcgtgccagaactgcccggacgtggtccaggcgctgaacctg
atggcggtgctgaacccgaacattcgccacgtcgccatcgacggtgcgctgttccaggcc
gaagtcgatgaacgccagatcatggccgtgccgagtgtgtacctcaacggtgtgaacttc
ggccagggccgcatgggcctggaagagattctcgccaagatcgacaccagcggtatcgaa
cgccaggccgagaaaatcagcgccaaggatgcttttgatgtgctggtggtcggcggtggc
ccggctggcgcttcggcggcgatctacgcggcccgtaaaggcatccgcactggcgtggcg
gccgaacgtttcggcggccaggtgctcgacaccatggccatcgagaacttcatctcggtc
caggaaaccgaagggccgaaactggccgttgccctggaagaacacgtcaagcagtacgac
gtggacatcatgaacctgcaacgtgccgacggcctggtgccaggcaaggacggcgggctg
catgaaatcaagttcgccagcggtgcgagcctcaaggccaaggcggtgatcctggcgacc
ggtgcccgctggcgtgaaatgaacgtgccgggcgagcagcagtaccgcaacaagggcgtg
gcgtactgcccgcactgcgacggtccgctgttcaaaggcaaacgcgtggcggtgatcggc
ggtggtaactccggcgtcgaggcggccatcgacctggccggtatcgtcgcccacgtcacg
ttgctggagttcgatgtgcaattgcgtgccgatgcggtattgcagcgcaaactgcacagc
ctgccgaacgtgacggtgattaccaacgcccagaccaccgaagtgaccggagacggtcag
aaggtcaatggcttgcgctacaaggaccgtccgagcggtgacgttcgggaggtggagttg
gaggggatcttcgtgcagatcggcttgttgcccaataccgattggctcaaaggcaccgtc
gagctgtcgccgcggggtgagattatcgtcgatgcccgaggtgaaacctcgatccctggc
gtgttcgccgccggtgacgtgaccaccgtgccgtacaagcagatcgtgattgccgtcggc
gagggcgccaaggcttcgctgagtgccttcgaccacctgatccgtacctctgcgccagca
taa

DBGET integrated database retrieval system