KEGG   Pseudomonas fluorescens F113: PSF113_2572Help
Entry
PSF113_2572       CDS       T01734                                 

Definition
(GenBank) Aldehyde dehydrogenase
Organism
pfe  Pseudomonas fluorescens F113
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Proho_convert
Motif
Other DBs
NCBI-ProteinID: AEV62579
UniProt: G8PWK3
LinkDB All DBs
Position
3028402..3029871
Genome map
AA seq 489 aa AA seqDB search
MNPTASLAPPRLAHPDKLFIDGQWLDARRGGRIDVISAHSEQVIARVAEATEEDVDLAVL
AARRAFDSGPWPRLSPAERAEYLRRLSAALAPRLPELAQAWTEQIGALASVSPFVVGAGH
YWFDYYAQLAGQFEFEASHPPMDGRGRALVVREAVGVVAAIAPWNNPFGIMAGKLAPALL
AGCTVIMKPAPETPIEAYIIAEAAEQIGLPAGVLNLVTTHREAADHLVCNPGVDKVSFTG
SVVAGQRIGSVCGGRIARYTLELGGKSAAIVLDDYDLGLAAKVLASTISMSCGQVCATLS
RVIVSRHRHDELLQALQTEMQAIRVGNPFDPSVQMGPLAMARQRSRVEEYIAIGQAEGAR
LISGGSRPADLPRGYYIEPTLFGGVERHMRIAQEEIFGPVLSVLPCDDEADAIRIANDSP
FGLYGAVFTDDAERAYRVARGVRTGTFSQNAFRFDPSLPFGGFKLSGVGREGGVHGLAGY
TELKSILLL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccaccgccagcctcgcgccaccccgtctcgcgcaccccgacaagctgtttatc
gatggtcaatggctcgatgcccggcgaggagggcggatcgacgtgatctcggcgcattcc
gagcaggtcattgcccgcgttgccgaggcgaccgaggaggacgttgacctggctgtcctc
gccgctcgccgggctttcgattccggcccctggccacggctcagtccggccgaacgagcc
gaatacttgcgccggttgtcggccgcgctggcaccgcgactgccagagctggcccaggcc
tggaccgaacaaatcggtgccttggcatctgtctcgccattcgtggtcggggccgggcac
tactggttcgactactacgcccagttggccgggcagttcgaattcgaagcatcacatccc
cccatggacggtcgtggacgggcgctggtggtacgcgaggccgttggcgtggtcgcagcc
atcgcaccgtggaacaacccgttcgggatcatggctggcaaactggccccggcgttgctg
gcgggctgcacggtgatcatgaaaccagccccggaaacgcccatcgaggcctacatcatc
gccgaggcggccgagcagatcggcttgccggccggtgtgctcaacctggtcaccacccac
cgcgaagcagccgatcacctggtgtgcaatcctggcgtggacaaggtcagtttcaccggc
tcggtcgtggccggccagcgcatcggctcggtctgtggcggtcgtatcgcccgctacacc
ttggagctgggtggcaagtccgccgccatcgttctggacgattacgacctgggcctggcg
gcgaaggtcctggcctcgaccatttcgatgtcttgtggccaagtctgcgcaaccctgagc
cgggtgatcgtttccaggcatcggcatgatgagctgctgcaggcgctgcagacggaaatg
caggcgatccgggtcggcaaccccttcgatccaagcgtgcagatgggcccccttgccatg
gcgcgccaacgttcacgggttgaggagtacatcgccatcggccaggccgaaggtgcccgt
ttgatcagcggaggcagccgtcccgcggacctgccgcgtggttattacatcgagccgacg
ttgttcggcggcgtggaacgccacatgcgcatcgcccaggaggaaatcttcggcccggtg
ctcagcgtcctgccctgcgatgacgaagcggatgccatccggattgccaatgactcgccg
ttcggcctttacggcgcggtgttcaccgacgatgccgagcgcgcctatcgggtggctcgc
ggggtgcgcaccggtaccttcagccagaacgcctttcgctttgatccgtctctgccgttt
ggtggcttcaagctgtccggggtcgggcgtgaaggtggggttcatgggctggccggttac
accgaactcaaatcgattctattgctgtag

DBGET integrated database retrieval system