KEGG   Pseudomonas fluorescens F113: PSF113_2933Help
Entry
PSF113_2933       CDS       T01734                                 

Gene name
ligD2
Definition
(GenBank) LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    PSF113_2933 (ligD2)
Enzymes [BR:pfe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PSF113_2933 (ligD2)
DNA repair and recombination proteins [BR:pfe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PSF113_2933 (ligD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AEV62937
UniProt: G8Q248
LinkDB All DBs
Position
complement(3448271..3450886)
Genome map
AA seq 871 aa AA seqDB search
MSRKTLDDYNRMRDFAATPEPAAKRSRKSARTAHALQFCIQKHDASRLHYDFRLELDGAL
KSWAVPKGPSLDPKAKRLAVHVEDHPLDYATFEGNIPEGHYGAGDVIVWDRGVWIPQDDP
HEAYEKGRLKFELQGEKLSGLWNLVRTHMPGKQEQWFLIKHQDQAARPESEYDVVQAEPN
SVLSDRTLVPKRRGKAATAKALKQPEKAVQAKSPRRAAKTTLSGAVAGPLPETLKPELAT
LVDSAPDGEWLYEIKFDGYRVMARIENGGVKLLTRNGHDWTHKLPRQAEALAALGLESAW
LDGEMVVANDQGVPDFQALQNAFEAGSSGKIAYYLFDMPYLNGMDLRKVPVQERRAALAA
VLEPNQSPLLRFSDAFEETPEALLNSACQMQMEGLIGKRIGSAYVSRRSNDWIKLKCKNR
QEFVVVGFSDPKGARSAFGALLLGLHDADSGQLRYAGKVGTGFNETTLKSIYQRLLPLER
KEPAVANPPTGYEAKGVHWLEPTLLAEVAFAEMTKDGSVRHAVFHGLRNDKPAKEITQEL
AKPMKKTAATKKTKAKDEPGATPAKTKSKAKAPALDGKVRITHPERVIDASSGTTKLQLA
EYYASVAEFILPELADRPAALVRAPDGIAGELFFQKNAERLAIPGITSLDKALTGQPVMI
INNAEALIGAVQMSTVELHTWNATSVDLDKPDRFVLDLDPDPALPWKSMVEATQLTLSVL
DELGLKAFLKTSGGKGIHVVVPLTRKLGWDEVKGFSHAIVSHMAKLLPDRFSAVSGPKNR
VGRIFIDYLRNGLGATTICAYAARTREGLPVSVPVFREEVAELKGANLWNVHNVHERLAQ
VGHEPWAGLKRTRQSITAEMRRRIGMRETDK
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcaaaaccctggatgactacaaccgcatgcgcgacttcgccgccaccccggag
ccggcggcgaagcgctcgcgcaaatcggcaagaaccgcccatgccttgcagttctgtatt
caaaaacacgacgcctcgcggctgcattacgattttcggctagagctggacggtgcgctc
aagagctgggcggtgcccaaaggcccctccctggacccgaaagccaagcgcctggcggtg
catgtcgaagaccatccgctggattacgccacgttcgagggcaacatccccgagggtcat
tacggcgccggtgacgttatcgtctgggaccgcggcgtctggattccccaggatgatccc
catgaggcctatgaaaagggccggctcaagttcgaactgcaaggcgaaaagctcagcggc
ctgtggaacctggtgcgcacccacatgcctggcaagcaggagcagtggtttctgatcaag
catcaggaccaggccgcccgccccgagagtgaatacgacgtggtccaggccgaaccgaac
agcgtgctcagcgatcgcaccctggtgcccaagcgccgcggcaaggccgcgacagccaaa
gcgctgaaacaaccggaaaaggccgtgcaggcgaaatcgccaagacgcgccgcgaaaacc
accctcagcggcgcggtcgccggaccgttgccggagaccctcaagccggaactggcaaca
ctggtggacagcgcgcccgacggcgaatggctctatgagatcaagttcgacgggtaccgg
gtcatggcgcgcattgaaaatggcggtgtaaagctgctgacccgcaacggccatgattgg
acccacaaattgccaagacaggccgaagccttggctgcgctgggcttggaatcggcctgg
ctcgacggcgagatggtggttgccaacgaccagggcgtgccggacttccaggccttgcag
aatgccttcgaggccggcagcagtggcaagattgcctattacctgttcgacatgccgtac
ctcaatggcatggatttgcgcaaagtgccagtgcaagaacgccgggcggcattggccgca
gtgctggagcccaatcaaagccccttgctgcggttttccgatgctttcgaggaaaccccc
gaagcactgctcaacagcgcctgccagatgcagatggaagggttgatcggcaagcgcatc
ggcagtgcctacgtgtccaggcgcagcaacgactggatcaagctcaagtgcaagaatcgc
caggagttcgtggtggtgggcttcagtgatcccaagggcgctcgcagcgccttcggtgcc
ttgctgctggggctgcatgacgctgacagcggccagttacgctatgccggcaaggttggc
accgggttcaacgaaaccacccttaaaagcatctaccagcgactactgcccctggagagg
aaagagcccgccgtggcgaatccgcccaccggctacgaagccaagggcgtgcactggctc
gaaccgacgctgttggccgaagtggcctttgccgaaatgaccaaggacggctcggtacgc
catgcggtcttccatggcttgcgcaatgacaagccggccaaggagattacccaggagctg
gccaagccgatgaaaaaaaccgctgcgacaaaaaaaaccaaagccaaggatgagcctggc
gcgacaccggccaaaaccaagagcaaggccaaggcaccggccttggacggcaaggtccgc
atcactcatccggagcgggtcattgacgccagcagcggcaccaccaagctgcaactggcc
gagtactacgccagcgtggccgaattcatcctgccagaactggcggatcgcccggcggcc
ttggtcagggcgccggatggcatcgccggggaactgttcttccagaagaacgccgagcgc
ctggcgattcccggtatcaccagtctggacaaggcgctgaccgggcagccggtgatgatc
atcaacaacgccgaggcgctgatcggcgcggtgcagatgagcacggtggagctgcacacc
tggaatgccacctcggtcgatctggacaagcctgaccgcttcgtcctcgaccttgacccg
gacccggcgttgccctggaaaagcatggtcgaggcgacgcaactcacgttatcggtgctc
gatgagctggggctcaaggcgtttctcaagaccagcggaggcaagggcatccatgtggtg
gtgccgctgacgcgcaagctgggttgggacgaggtcaaggggttcagccatgcgattgtc
agtcacatggccaagctgctgccggaccgtttttcggcggtgtccgggccgaagaatcgg
gtagggcggattttcatcgattacctgcgcaatgggttgggcgctaccaccatctgtgcc
tacgccgctcggacccgggaagggttgccggtttcagtgcctgtttttcgtgaggaggtg
gccgagctcaagggggcgaatttgtggaatgtgcataacgttcatgagcgtctggcgcaa
gttgggcatgagccttgggctgggcttaagcgaactcggcagagtattacggctgagatg
cgtaggcgtattggtatgagggagacggataagtag

DBGET integrated database retrieval system