KEGG   Pseudomonas fluorescens F113: PSF113_3840Help
Entry
PSF113_3840       CDS       T01734                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00010  Glycolysis / Gluconeogenesis
pfe00052  Galactose metabolism
pfe01100  Metabolic pathways
pfe01110  Biosynthesis of secondary metabolites
pfe01120  Microbial metabolism in diverse environments
pfe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSF113_3840
   00052 Galactose metabolism
    PSF113_3840
Enzymes [BR:pfe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PSF113_3840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEV63841
UniProt: G8PXN2
LinkDB All DBs
Position
4533218..4534369
Genome map
AA seq 383 aa AA seqDB search
MLESRQLLTALGVSLMIATSASQAAGLTNERGAFGKTDDGTAVEKFVLRNSHGVEATVIT
YGGILQSLSVPDKNGKAADIVLGFDDVQGYQKNGSVYFGATIGRFGNRLAGGAFELDGKR
YQVPQNDHGNSLHGGPQGFDKRVWKAQPHNAKDSVGVTLTYLSPDGEMGFPGALKTDVTY
SLNEQNELRIEYKATTDKPTVLNLTNHSYFNLAGAGNGDILEQLATLHAAHYTPVTGKLI
PTGELAPVAGTPMDFTQPTAIGTHIKADHPQLKFAEPKQGGFDFNWALDAKGDVNKLAAE
VYDTDSGRRLQLYTTEPGVQFYTSNFLDGTVKGKQGKVYPHWGAFTLETQHYPDSPNQPN
FPSTRLDPGQTYTQTMVLKFSAK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaatccagacaactgctcacggccctcggagtgtccctgatgatcgccacctcg
gcttcccaggctgccggcctgaccaacgaacgcggtgcattcggcaagaccgacgacggc
acggcggtggaaaaattcgtgctgcgcaacagtcacggcgtggaggccacggtcatcacc
tacggcggcatcctccagtcattgagcgtgccggacaaaaacggcaaggccgccgacatc
gtgctcggcttcgacgacgtgcagggttaccagaagaacggcagcgtgtatttcggcgcg
accatcggccgctttggcaatcgcctggccggcggcgccttcgagctggacggcaagcgt
taccaagtgccgcagaacgaccatggcaactccctgcacggcgggccgcaagggttcgac
aagcgcgtctggaaggctcagccgcacaatgccaaggactcggtgggcgtcaccctgacc
tacctgtcacccgatggcgagatgggctttcccggtgcactgaagaccgacgtcacctac
agcctcaacgaacagaacgagttgcggatcgagtacaaagccaccaccgacaagcccaca
gtgctgaacctgaccaaccacagctatttcaacctggccggcgcaggcaacggcgacata
cttgagcagctcgcgaccctgcacgcggcccactacacgccggtcaccggcaaactcatt
cccaccggcgaactggcccccgtggctggtacgccgatggacttcacccaacccaccgcc
atcggcacccacatcaaggccgatcacccacaactcaaattcgccgaaccgaaacaaggc
ggcttcgatttcaactgggccctggacgccaaaggcgacgtgaacaaactggccgccgag
gtgtatgacacggactccggacgacgcctgcagctctacaccaccgaacccggcgtgcag
ttctacaccagcaacttcctcgacggcaccgtcaagggcaagcaaggcaaggtctatccg
cattggggcgcgttcaccctggaaacccagcactaccccgactcgcccaaccagccgaac
ttcccctcgacgcggcttgatccgggccagacctacacccagaccatggtgttgaagttc
tccgcaaaataa

DBGET integrated database retrieval system