KEGG   Pseudomonas fluorescens F113: PSF113_4224Help
Entry
PSF113_4224       CDS       T01734                                 

Gene name
fabA
Definition
(GenBank) FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00061  Fatty acid biosynthesis
pfe01100  Metabolic pathways
pfe01212  Fatty acid metabolism
Module
pfe_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PSF113_4224 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pfe01004]
    PSF113_4224 (fabA)
Enzymes [BR:pfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PSF113_4224 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     PSF113_4224 (fabA)
Lipid biosynthesis proteins [BR:pfe01004]
 Fatty acid synthase
  Component type
   PSF113_4224 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AEV64220
UniProt: G8Q2C6
LinkDB All DBs
Position
4949814..4950329
Genome map
AA seq 171 aa AA seqDB search
MTKQNAFTREDLLRCSRGELFGPGNAQLPAPNMLMVDRITHISEEGGKYGKGELVAELDI
TPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFFLGWQGLPGRGRALGSGEVKFFGQVLPT
AKKITYNIHIKRVLKGKLNMAIADGSVAVDGREIYTAEGLRVGVFTSTDNF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacaaaacgcctttacccgggaagatctgctgcgctgcagtcgcggtgagctg
ttcggcccaggtaacgcgcaactgcccgccccgaacatgctgatggtggatcgcatcacc
catatcagcgaagagggtggcaagtacggcaaaggtgaattggtcgccgagctggatatc
actccggacctgtggttcttcgcctgccacttcgaaggtgatccggtcatgccgggctgc
ctgggcctggacgccatgtggcaactggtcggtttcttcctcggctggcaaggcctgccg
ggtcgcggtcgcgccctgggctcgggcgaagtgaagttctttggtcaggtcctgccgacc
gccaagaaaatcacctataacattcatatcaagcgtgtcctcaagggcaagctgaacatg
gccattgccgatggttcggtcgccgtggatggtcgcgagatctacaccgccgaaggcctc
cgggttggcgttttcacctccactgacaacttctaa

DBGET integrated database retrieval system