KEGG   Pseudomonas fluorescens F113: PSF113_4241Help
Entry
PSF113_4241       CDS       T01734                                 

Gene name
sdhB
Definition
(GenBank) SdhB
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00020  Citrate cycle (TCA cycle)
pfe00190  Oxidative phosphorylation
pfe00650  Butanoate metabolism
pfe01100  Metabolic pathways
pfe01110  Biosynthesis of secondary metabolites
pfe01120  Microbial metabolism in diverse environments
pfe01130  Biosynthesis of antibiotics
pfe01200  Carbon metabolism
Module
pfe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pfe_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSF113_4241 (sdhB)
   00650 Butanoate metabolism
    PSF113_4241 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PSF113_4241 (sdhB)
Enzymes [BR:pfe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PSF113_4241 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     PSF113_4241 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AEV64237
UniProt: G8Q3B6
LinkDB All DBs
Position
complement(4969639..4970343)
Genome map
AA seq 234 aa AA seqDB search
MLQVSVYRYNPDQDAAPFMQEFQVDTGGKDLMVLDVLALIKEQDEGFSYRRSCREGVCGS
DGMNINGKNGLACITPLSAVVKGNKLIVRPLPGLPVIRDLVVDMSIFYKQYEKVKPYLQN
DTPAPAIERLQSPEEREKLDGLYECILCACCSTSCPSFWWNPDKFLGPAALLQAYRFLAD
SRDTKTSERLAALDDPFSVFRCRGIMNCVNVCPKGLNPTKAIGHVRNMLLQSGV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaagtcagtgtttatcgctacaaccctgatcaggacgctgcgccgttcatgcag
gaattccaggtcgataccggtggtaaagacctgatggtgctggacgtgctggccctgatc
aaagagcaggacgagggtttctcctatcgtcgctcttgccgcgagggcgtttgcggctcc
gacggcatgaacatcaacggcaagaacggcctggcctgcatcacgccgctgtctgcggtg
gtcaagggcaacaagctgatcgttcgtccgttgccaggtttgccggttatccgtgacctg
gtcgtcgatatgagcatcttctacaagcaatacgagaaggtgaagccatacctgcagaac
gacacgccggctccggccatcgagcgtctgcagtctccagaagagcgtgaaaagctcgac
ggtctgtacgagtgcatcctgtgcgcttgctgctcgacctcgtgcccatcgttctggtgg
aacccggacaagttcctgggcccggccgccctgctgcaagcgtaccgcttcctggcagac
agccgtgacaccaagacgtccgagcgtctggctgcactggatgacccgttcagcgtattc
cgctgccgcgggatcatgaactgcgtcaacgtctgcccgaaaggcctgaacccgactaag
gccatcggtcacgtacgtaacatgctgctgcagagcggcgtgtga

DBGET integrated database retrieval system