KEGG   Pseudomonas fluorescens F113: PSF113_4242Help
Entry
PSF113_4242       CDS       T01734                                 

Gene name
sdhA
Definition
(GenBank) SdhA
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00020  Citrate cycle (TCA cycle)
pfe00190  Oxidative phosphorylation
pfe00650  Butanoate metabolism
pfe01100  Metabolic pathways
pfe01110  Biosynthesis of secondary metabolites
pfe01120  Microbial metabolism in diverse environments
pfe01130  Biosynthesis of antibiotics
pfe01200  Carbon metabolism
Module
pfe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pfe_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSF113_4242 (sdhA)
   00650 Butanoate metabolism
    PSF113_4242 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PSF113_4242 (sdhA)
Enzymes [BR:pfe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PSF113_4242 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     PSF113_4242 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA HI0933_like FAD_binding_3 Thi4 Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AEV64238
UniProt: G8Q3B7
LinkDB All DBs
Position
complement(4970355..4972127)
Genome map
AA seq 590 aa AA seqDB search
MANIPTISFDAIIIGGGGAGMRAALQLAQGGHKTAVITKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCQEGPAAVYELDHMGMPFSRTEQGRIYQRP
FGGQSKDYGKGGQAARTCAASDRTGHALLHTLYQGNLKAGTVFLNEYYAVDLVKNQDGAF
VGVIAICIETGETTYIRAKATVLATGGAGRIYASTTNALINTGDGVGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINKHGERFMERYAPNAKDLAGRDVVARSMVKEI
IAGNGCGPNGDHVMLKLDHLGEEVLHSRLPGICELSKTFAHVDPVVAPVPVVPTCHYMMG
GVATNIHGQAITQNAEGVDEIIPGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLH
LEKALSDGIEYDDATDANIEAALARLSALNERTEGEDVATLRRELQNCMQNYFGVFRTGE
YMQKGIAQLAQLRERIANVKINDKSQAFNTARIEALELQNLLEVAEATAIAAEVRKESRG
AHAREDFEDRDDENWLCHTLYFPGDKRVTKRAVNFSPKTVPTFEPKIRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggctaacattccaacgatttctttcgacgccatcatcattggtggtggcggtgccggc
atgcgcgcggcgctgcaactggcacagggcggtcacaagactgccgtgatcaccaaggtc
ttcccgacccgttcgcacactgtttccgcccagggcggcatcacctgcgccatcgcttcg
gccgacccgaacgatgactggcgctggcacatgtacgataccgtcaagggttccgactat
atcggtgaccaggatgctatcgaatacatgtgtcaggaaggtccggctgccgtttacgaa
ctggaccacatgggcatgcctttctcgcgtaccgagcaaggtcgtatctaccagcgtccg
ttcggtggccagtccaaggactacggcaagggcggtcaggccgcacgtacttgcgcagcg
tccgaccgtaccggtcacgcactgctgcacaccctttatcagggcaacctgaaagccggt
accgtgttcctgaacgagtactacgcggtcgatctggtgaagaaccaggatggcgctttt
gtcggcgtgatcgcgatctgcatcgaaaccggcgaaaccacctacatccgcgccaaggcc
accgtactggcgaccggcggtgcaggtcgtatctatgcctccaccaccaatgccctgatc
aacaccggtgacggcgtcggcatggccctgcgtgcaggcgtaccggtgcaagacatcgaa
atgtggcagttccacccaaccggcatcgccggcgccggtgtactggtcaccgaaggttgc
cgcggtgaaggcggttacctgatcaacaagcacggcgagcgtttcatggagcgttatgct
ccgaacgccaaggaccttgctggtcgtgacgtggttgcccgttcgatggttaaagagatc
atcgccggcaacggctgtggcccgaatggcgaccacgtgatgctcaagctcgaccacctg
ggcgaggaagtgctgcacagccgcctgccaggcatctgcgaactgtccaagaccttcgct
cacgtcgacccggtcgttgcaccggttccagtggttccaacctgccactatatgatgggc
ggcgttgccaccaacattcatggccaggcaatcacccagaacgccgaaggcgtggacgaa
atcatccctggcctgttcgcagtgggtgaagtggcgtgcgtatcggtccacggtgccaac
cgcctgggcggcaactcgttgctcgacctggtggtcttcggtcgcgctgctggcctgcac
ctggaaaaagccctgtccgacggtatcgaatacgacgatgccaccgacgccaacatcgaa
gccgccctggcgcgtctgtccgctctgaacgagcgtaccgaaggcgaagacgtggcgacc
ctgcgtcgcgaattgcaaaactgcatgcagaactacttcggtgtattccgtaccggcgaa
tacatgcagaagggtattgcccagctggcgcaattgcgtgaacgaatcgccaacgtgaag
atcaacgataagtcgcaggcgttcaacactgcccgtatcgaagcgctggaattgcagaac
ctgctggaagtggctgaagctaccgccattgctgccgaagtacgtaaagagtcccgcggc
gctcacgcccgtgaagacttcgaagatcgtgacgacgaaaactggctgtgccacaccctt
tacttcccgggtgacaagcgcgtgaccaagcgtgctgtgaacttctcgccgaagactgtt
ccgacttttgaacctaagattcggacttattaa

DBGET integrated database retrieval system