KEGG   Pseudomonas fluorescens F113: PSF113_5487Help
Entry
PSF113_5487       CDS       T01734                                 

Gene name
tktA
Definition
(GenBank) TktA
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00030  Pentose phosphate pathway
pfe01100  Metabolic pathways
pfe01110  Biosynthesis of secondary metabolites
pfe01120  Microbial metabolism in diverse environments
pfe01130  Biosynthesis of antibiotics
pfe01200  Carbon metabolism
pfe01230  Biosynthesis of amino acids
Module
pfe_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pfe_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PSF113_5487 (tktA)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    PSF113_5487 (tktA)
Enzymes [BR:pfe01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     PSF113_5487 (tktA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh DXP_synthase_N TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AEV65459
UniProt: G8Q2I9
LinkDB All DBs
Position
complement(6351546..6353543)
Genome map
AA seq 665 aa AA seqDB search
MPSRRERANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDYLKHSPSNPSFADRDRF
VLSNGHGSMLIYSLLHLTGYDLSIDDLKSFRQLHSRTPGHPEYGYTPGVETTTGPLGQGL
ANAVGFALAEKVLAAQFNRPGHNVVDHHTYVFLGDGCMMEGISHEVASLAGTLGLDKLIA
FYDDNGISIDGEVEGWFTDDTPKRFEAYNWLVIRNVDGHDPEEIKTAIETARKSAQPTLI
CCKTTIGFGSPNKQGKEDCHGAPLGAEEIALTRAALKWDHGPFEIPADIYAEWDAKEKGR
ALEAEWDQRFAAYSAEFPELANELVRRLSGELPADFAEKASAYIAEVAAKGETIASRKAS
QNTLNAFGPLLPELLGGSADLAGSNLTLWKGCKGVSAEDASGNYMYYGVREFGMSAIMNG
VALHGGLVPYGATFLMFMEYARNAVRMSALMKKRILYVFTHDSIGLGEDGPTHQPIEQLA
SLRCTPNLDTWRPCDAVESAVAWKHAIERNDGPSALIFSRQNLQHQNRGADQIGDIARGG
YVLKDCIGEPELILIATGSEVGLAVQAYDKLTEQGRNVRVVSMPCTSVFDAQDAGYKQAV
LPLQVSARIAIEAAHADYWYKYVGLEGRVIGMTTYGESAPAPALFEEFGFTLENILGQAE
ELLED
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgcccagccgtcgtgagcgtgccaatgccattcgtgccctcagcatggatgccgtgcag
aaagccaacagcggccatcccggtgcccccatgggtatggcggatatcgccgaggtgctt
tggcgcgactacctcaagcacagcccgagcaacccatcgttcgccgaccgtgaccgcttc
gtgctgtccaatggtcacggctcgatgttgatctactcgctgctgcacctgaccggctac
gacttgtcgatcgatgacctgaagagcttccgtcaactgcacagccgcaccccgggccac
ccggaatacggctacaccccaggcgtggaaaccaccaccggtccattgggccagggcctg
gccaacgccgtgggctttgccctggcagaaaaagtcctggccgcgcagttcaaccgcccg
ggccataacgtcgtcgatcaccacacctacgtattcctgggtgatggctgcatgatggaa
ggcatttcccacgaagtcgcctccctggccggcaccctgggcctggacaagctgatcgct
ttctatgacgacaacggcatctccatcgatggcgaagtcgaaggctggttcaccgacgac
actcccaagcgcttcgaagcctacaactggctggtgatccgcaatgtcgacggtcacgat
ccggaagagatcaagactgccatcgagacggcccgcaaaagcgcccagccgaccctgatc
tgctgcaagaccaccatcggtttcggctcgccgaacaagcaaggcaaggaagactgccac
ggcgcgccattgggtgccgaagaaattgccctgacccgcgctgcgctgaagtgggaccat
ggcccgttcgaaatcccggccgacatttatgccgagtgggatgccaaggaaaaaggccgc
gcgctcgaagccgaatgggaccagcgtttcgccgcgtattccgccgaattccctgagctg
gccaacgagctggtgcgtcgcctcagtggcgagctgccggccgacttcgccgaaaaagcc
tcggcgtacatcgctgaagtcgccgccaagggcgaaaccatcgccagccgcaaggccagc
cagaacaccttgaacgccttcggcccattgctgccggaactgctgggcggttcggccgac
ctggccggttccaacctgaccctgtggaaaggctgcaaaggcgtcagcgccgaagatgcc
agcggcaactacatgtactacggcgttcgcgagttcggcatgagcgcgatcatgaacggc
gtggcgctgcacggcggcctggtgccttacggcgcgaccttcctgatgttcatggaatat
gcccgcaacgcagtgcgcatgtcggcgctgatgaaaaaacgcatcctgtatgtgttcacc
cacgactccatcggcctgggcgaagacggcccgactcaccagccgatcgagcaactggcg
agcctgcgttgcacgccgaacctggacacctggcgcccttgcgatgccgtggagtcggcg
gtggcctggaaacacgccatcgagcgcaacgacggtccatcggcgctgatcttctcccgc
cagaacctgcagcaccagaaccgcggtgccgaccagatcggcgatatcgctcgcggcggc
tacgtactcaaggactgcatcggcgagccggagctgatcctgatcgccactggttccgaa
gtcggtctggccgttcaggcctacgacaagctgaccgagcagggccgcaacgtgcgcgta
gtgtccatgccgtgcaccagcgtgttcgacgctcaggatgccggctacaagcaagcggtg
ttgccgctgcaggtcagtgcgcggatcgccatcgaggctgcccacgccgattactggtac
aagtacgtgggcctggaaggccgcgtgatcggcatgaccacctacggcgagtcggcacct
gcgccggcgctgttcgaggaattcggcttcaccctggaaaacatcctgggtcaggcggaa
gagctgctggaagactga

DBGET integrated database retrieval system