KEGG   Pseudomonas fluorescens PICF7: PFLUOLIPICF702175Help
Entry
PFLUOLIPICF702175 CDS       T03767                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pff  Pseudomonas fluorescens PICF7
Pathway
pff00620  Pyruvate metabolism
pff00680  Methane metabolism
pff01100  Metabolic pathways
pff01120  Microbial metabolism in diverse environments
pff01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pff00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PFLUOLIPICF702175
  09102 Energy metabolism
   00680 Methane metabolism
    PFLUOLIPICF702175
Enzymes [BR:pff01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PFLUOLIPICF702175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJZ92458
LinkDB All DBs
Position
complement(465386..468013)
Genome map
AA seq 875 aa AA seqDB search
MSDIDARLREDVHLLGELLGNTIREQYGDDFLDKIEQIRKGAKADRRGAGDELSTRLNQL
QENELLPVARAFNQFLNLANIAEQYQLIHRRDESQPAPFESRVLPELLARLQSEGHSNES
LARQLGRLEIELVLTAHPTEVARRTLIQKYDAIAAQLAAQDHRDLTTAEREQIRQRLQRL
IAEAWHTEEIRRTRPTPVDEAKWGFAVIEHSLWHAIPNYLRKADQALHAATGLRLPLEAA
PIRFASWMGGDRDGNPNVTAPVTREVLLLARWMAADLYLRDIDHLASELSMQQASPALQA
KVGDSVEPYRALLKQLRERLRATRQWAHTALSSSTPAPADVLQNNRDLLEPLELCYHSLH
ACGMGVIADGPLLDCLRRAVTFGLFLVRLDVRQDSSRHSAAMTEITDYLGLGRYEDWDEE
ARISFLMKELANRRPLLPGYFKPSADTAEVLNTCKEIAAAPAASLGSYVISMAGAASDVL
AVQLLLKESGVQRPMRVVPLFETLADLDNAGPVIEQLLLLPGYRARLQGPQEVMIGYSDS
AKDAGTTAAAWAQYRAQERLVDICREQQVELLLFHGRGGTVGRGGGPAHAAILSQPPGSV
AGRFRTTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLLPPPPPEPAWRHLMDELAADG
VSAYRAVVRENPQFVEYFRQSTPEQELGRLPLGSRPAKRRAGGIESLRAIPWIFGWTQTR
LMLPAWLGWEAALSKALERGEGELLGQMREQWPFFRTRIDMLEMVLAKADADIARLYDER
LVQPDLLPLGAHLRDLLSQACSVVLGLTGQSQLLAHSPDTLEFIRLRNTYLDPLHLLQAE
LLARSRQQEAAQDSPLEQALLVSVAGIAAGLRNTG
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatatcgatgcacgcttgcgtgaggatgttcacctgctgggtgagctgttgggc
aacaccattcgagagcagtacggcgatgatttcctcgacaagatcgagcagatccgcaaa
ggcgccaaggcggaccgtcggggggccggggatgagctgagcacccgcctcaaccagttg
caggaaaatgaactgttgccggtagcacgggcgttcaaccagtttctcaacctggccaac
atcgccgagcagtaccaactgatccaccggcgtgatgagtcccagccggcaccgttcgag
tcccgcgtattgcccgagttgctggcgcgcctgcaaagcgaaggccacagcaacgaatcc
ctggcccgccagttggggcgcctggagatcgaactggtgctcaccgcccaccctaccgaa
gtggcgcgtcgcaccctgatccagaaatacgatgccatcgccgcccaactggcggcgcag
gatcatcgcgacctcaccaccgcagagcgcgagcagatccgccagcgcctgcaacgcttg
atcgccgaggcctggcacaccgaagaaatccgccgcacccggcccacgccggtggacgaa
gccaagtggggctttgcggtgatcgagcattcgctgtggcacgcgattcccaattatctg
cgcaaggccgatcaggcgctgcatgccgccaccggtttgcgcttgcccctggaagccgcg
ccgatccgctttgcctcgtggatgggcggcgaccgtgacggcaacccgaatgtcacggcg
ccggtcacccgtgaagtcttactgttggcgcgttggatggctgccgacctctacctgcgc
gatatcgaccacttggcctccgagctgtcgatgcagcaagccagcccggcgttgcaggcc
aaggtcggtgatagcgtcgaaccttatcgtgccttgctcaagcaactgcgcgagcgcctg
cgggcgacgcgccaatgggcgcataccgcgttaagcagcagtaccccggcgccggccgac
gtattgcagaacaatcgcgacctgctggagccgctggagctgtgctatcactcgctacac
gcgtgcggcatgggggtgattgccgatggcccgttactcgactgcctgcgtcgggcggtg
acgttcgggctgttcctggtgcgtctggatgtgcgtcaggattccagtcgccattcggcc
gccatgacggaaatcaccgattacctcggcctgggtcggtacgaggactgggacgaagag
gcacgtatcagtttcctgatgaaggaactggctaaccgtagacccctgctgccgggctat
ttcaagccgtcggcggacactgccgaggtgctcaacacctgtaaggaaatcgccgccgca
ccggctgcatcgttgggctcttatgtcatctccatggccggcgctgcctcggacgtgctt
gcagtgcaactgttgcttaaagagtcgggcgtgcaacggccgatgcgtgtggtgccactg
ttcgaaaccctggccgacctggataacgccggcccggtgatcgagcaactgttgctgttg
ccgggctatcgcgcgcgtttgcaagggccgcaggaagtgatgatcggctactcggactcg
gccaaggacgccggcactaccgcggcagcctgggcacagtaccgcgcgcaggaacggctg
gtggatatctgccgcgagcagcaggtggagctgctgttgttccacggtcggggcggcacc
gttggccgtggcggcggcccggcccacgctgcgatcctgtcgcagccaccgggttcggtg
gcggggcggttccgcaccaccgaacagggcgagatgatccgcttcaagttcggcctgccg
gatatcgccgagcagaacctcaatctctatctggctgcggtattggaagcgaccctgctg
ccaccaccgccgccagagccggcctggcgccatttgatggatgaattggcggcagacggt
gtcagcgcttaccgcgccgtggtgcgggaaaatccgcagttcgtcgagtatttccgccaa
tccacgccggaacaggagctgggtcgtttgcctctgggcagtcgcccggccaaacgccgt
gcgggtggaattgaaagcttgcgtgcgattccctggatcttcggctggacccagactcgc
ctgatgctgccggcctggctcgggtgggaggcggcgctgagcaaggcgctggaacgcgga
gaaggcgagctgctggggcagatgcgcgagcagtggccgttcttccgtacccgcatcgac
atgttggaaatggtgctggccaaagccgatgccgatatcgcccgcctgtatgacgagcgc
ctggtgcagccggacctgctgccattgggtgcacatctgcgcgacctattgtcgcaggcg
tgcagcgtggtgcttggcctgaccggccagtcgcaactgttggcccatagcccggacacc
ctggagttcatccgattgcgcaacacctaccttgaccccttgcacttgctgcaggccgag
ttgctggcgcgctcacgccagcaggaagcggcacaggacagccctctggaacaggcgctg
ctggtctccgtggccggtatcgccgctggtttgcgtaacactggctag

DBGET integrated database retrieval system