KEGG   Pseudomonas simiae PICF7: PFLUOLIPICF703585Help
Entry
PFLUOLIPICF703585 CDS       T03767                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pff  Pseudomonas simiae PICF7
Pathway
pff00473  D-Alanine metabolism
pff00550  Peptidoglycan biosynthesis
pff01100  Metabolic pathways
pff01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pff00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PFLUOLIPICF703585
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PFLUOLIPICF703585
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PFLUOLIPICF703585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pff01011]
    PFLUOLIPICF703585
Enzymes [BR:pff01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PFLUOLIPICF703585
Peptidoglycan biosynthesis and degradation proteins [BR:pff01011]
 Precursor biosynthesis
  Amino acid ligase
   PFLUOLIPICF703585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATP-grasp_5 ATPgrasp_Ter ATPgrasp_YheCD TTL GARS_A
Motif
Other DBs
NCBI-ProteinID: AJZ92698
LinkDB All DBs
Position
complement(781329..782285)
Genome map
AA seq 318 aa AA seqDB search
MINDYGSLLSTIAPADFGRVAVLFGGKSAEREVSLKSGNAVLDALQSAGVNAFGIDVGDD
FIARLQAEKIDRAFIILHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHSVLCSEDDCISAAKELGLPLIVKPAHEGSSIGMAKVNSAAELIDAWKAAST
YDSQVLVEQWIQGPEYTIATLRGQVLPPIALGTPHTFYDYDAKYLASDTQYRVPCGLDAS
KEQELMDLTAKACEALGIAGWARADVMQDDQGNFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILADSIEPRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgactacggctccctgctctcgacaatcgcacctgccgacttcggtcgcgta
gcggtgttgttcggtggcaaaagcgctgaacgcgaagtctcgctcaagtccggaaacgcc
gtgctcgacgccctgcaaagcgctggcgtgaacgccttcggcatcgacgtgggcgatgac
ttcatcgcccgcctgcaggccgagaagatcgaccgcgccttcatcatcctccacggccgt
ggcggtgaagacggcagcatgcaaggcctgctggagtgcgccggcatcccctacaccggc
agtggcatcctggcttccgcgctggcgatggacaagttgcgcaccaaacaggtgtggcac
agcctgggtattccgaccccgcgtcacagtgttctgtgcagcgaagacgattgtatttct
gccgccaaggaactgggcctgcctttgatcgtcaaaccagcccatgaaggctccagtatc
ggcatggccaaagtgaactcggccgccgaattgatcgacgcatggaaagcggcaagtacc
tacgattcgcaagtgttggtggaacagtggatccagggtcccgagtacaccatcgccacc
ctgcgtggccaggtattgccgcctatcgcattgggcacgccccacaccttttatgactac
gacgccaagtacctggcttccgatacccagtaccgggtcccctgcggccttgacgcaagc
aaagaacaggaattgatggacctcacggcgaaagcctgtgaggcgctgggtatcgccggt
tgggcgcgagcagacgtgatgcaggatgaccaagggaatttctggttcctggaagtcaac
accgcaccgggcatgacggatcacagtttggtacctatggcagcccgtgcggccggtttg
gacttccagcagttagtgctggcgatcctggccgacagcattgagccaagaggctaa

DBGET integrated database retrieval system