KEGG   Pseudomonas fluorescens PICF7: PFLUOLIPICF704000Help
Entry
PFLUOLIPICF704000 CDS       T03767                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pff  Pseudomonas fluorescens PICF7
Pathway
pff00970  Aminoacyl-tRNA biosynthesis
pff01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pff00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PFLUOLIPICF704000 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pff03029]
    PFLUOLIPICF704000 (gatB)
Enzymes [BR:pff01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PFLUOLIPICF704000 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PFLUOLIPICF704000 (gatB)
Mitochondrial biogenesis [BR:pff03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PFLUOLIPICF704000 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AJZ92779
LinkDB All DBs
Position
862633..864078
Genome map
AA seq 481 aa AA seqDB search
MQWEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNQEAVRMAV
MFGLAIDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDIPLEDGTIKRVGVT
RAHLEEDAGKSLHEEFPGATGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKTIHALVRYL
GICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEVRRQIELIED
GGKVIQQTRLYDPNKDETRAMRSKEEANDYRYFPDPDLLPVVLEDSFLNDIRATLPELPQ
QKRERFQAQFGLSVYDASVLASSREQANYFEKVVSIAGDAKLAANWVMVELGSLLNKQGL
EIDEAPVSAEQLGGMLLRIKDNTISGKIAKTVFEAMASGEGSADEIIEKRGLKQVTDSGA
ISAVLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKSKLE
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgggaagttgtgatcgggctggagattcatacccagctcgccacccaatcgaag
attttctccggtagcgccaccacgttcggctccgagcccaacacccaggccagcctggtc
gacctgggcatgcccggcgtactgccggtgctgaaccaggaagcggtgcgcatggcggtg
atgttcggcctggcaattgacgccgagatcggccagcacaacgtgttcgcgcgcaagaac
tacttctacccggacctgcccaaaggctaccagatcagccagatggaactgccgatcgtc
ggcaagggccacctggacattcctctggaagacggcaccatcaagcgcgtcggcgtaacc
cgcgcgcacttggaagaagacgccggtaaaagcctgcacgaagaattcccgggcgccacc
ggtatcgacctgaaccgtgccggcacgccgctgctggaaatcgtgtccgagccggacatg
cgcagtgccaaggaagccgtagcctacgtcaagactatccacgcgctggtgcgctacctg
ggcatctgcgacggcaacatggctgaaggttcgctgcgttgcgactgcaacgtgtcgatc
cgtccaaagggccaggtcgagttcggcactcgctgcgagatcaagaacgtcaactcgttc
cgcttcatcgagaaagcgatcaacagcgaagtacgtcgccagatcgagctgatcgaagac
ggtggcaaggtcatccagcaaacccgcctgtacgacccgaacaaagatgaaacccgcgcc
atgcgcagcaaagaggaagccaacgactaccgttacttccccgatccggacctgttgccg
gtggtgcttgaggactcgttcctcaacgacatccgggccaccctgccggaattgccgcag
cagaaacgcgaacgcttccaggcgcagttcggcctgtcggtctacgacgccagcgtgttg
gcttccagccgtgagcaagccaactactttgaaaaagtcgtgagcattgccggtgacgcc
aagctggcggccaactgggtgatggttgaactgggcagcctgttgaacaagcagggcctg
gaaatcgacgaagccccggtctctgccgagcaattgggcggcatgctgctgcgcatcaag
gacaacaccatctccggcaaaatcgccaagaccgtgtttgaagcgatggccagcggtgaa
ggcagcgccgatgaaatcatcgagaaacgcggtctcaagcaagtcaccgacagcggcgcg
atctcggccgtgctggatgaaatgctcgcagccaacgccgagcaggtcgaacagtaccgt
gcggcggacgaagccaagcgcggcaagatgttcggcttctttgtcggccaggcgatgaaa
gcctccaaaggcaaggccaacccgcaacaggtgaacgaactgctgaaaagcaagctcgaa
ggctga

DBGET integrated database retrieval system