KEGG   Pseudomonas fluorescens PICF7: PFLUOLIPICF704065Help
Entry
PFLUOLIPICF704065 CDS       T03767                                 

Gene name
sspA
Definition
(GenBank) stringent starvation protein A
  KO
K03599  stringent starvation protein A
Organism
pff  Pseudomonas fluorescens PICF7
Brite
KEGG Orthology (KO) [BR:pff00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pff03021]
    PFLUOLIPICF704065 (sspA)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pff02000]
    PFLUOLIPICF704065 (sspA)
Transcription machinery [BR:pff03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     PFLUOLIPICF704065 (sspA)
Transporters [BR:pff02000]
 Other Transporters
  Pores ion channels [TC:1]
   PFLUOLIPICF704065 (sspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: AJZ92791
LinkDB All DBs
Position
complement(875743..876360)
Genome map
AA seq 205 aa AA seqDB search
MGVTNRLACYSDPADHYSHRVRIVLAEKGVSAEIISVEAGRQPPKLIEVNPYGSLPTLVD
RDLALWESTVVMEYLDERYPHPPLLPVYPVARANSRLLIHRIQRDWCGLVDVILDTRSKE
AARVQARKELRESLTGVSPLFADKPFFLSEEQSLVDCCLLPILWRLPILGIELPRPAKPL
LDYMERQFAREAFQASLSGVERDMR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgaccaatcggttggcctgttactccgaccccgccgaccactattcccaccga
gtgcgcatcgtgctcgcagagaagggtgtcagcgccgagatcatcagtgtggaggcgggc
cgtcagccgccaaaactgatcgaagtgaacccttacggcagcttgcccaccctggtcgat
cgtgacctggcgttgtgggagtcgaccgtcgtgatggaatacctggatgagcgttacccg
catccgcctttgctgccggtgtacccggtggcgcgtgccaacagccggctgctgatccat
cggatccagcgtgactggtgtggtctggtggatgtgattctggatacccgcagcaaagag
gcggcacgtgtacaggcgcgtaaggaattgcgcgaaagcctgaccggcgtttcgccgctg
ttcgccgataaaccttttttcctcagtgaggaacaaagcttggtggattgctgcctatta
ccgatactctggcgtttgccgattcttggtattgaactgccgcggcctgccaagccgctg
cttgattacatggagcgccagtttgcgcgtgaggctttccaggcgagtctgtctggtgtc
gaacgcgatatgcgctaa

DBGET integrated database retrieval system