KEGG   Pseudomonas fluorescens PICF7: PFLUOLIPICF705285Help
Entry
PFLUOLIPICF705285 CDS       T03767                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
pff  Pseudomonas fluorescens PICF7
Pathway
pff00061  Fatty acid biosynthesis
pff00620  Pyruvate metabolism
pff00640  Propanoate metabolism
pff01100  Metabolic pathways
pff01110  Biosynthesis of secondary metabolites
pff01120  Microbial metabolism in diverse environments
pff01130  Biosynthesis of antibiotics
pff01200  Carbon metabolism
pff01212  Fatty acid metabolism
Module
pff_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pff00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PFLUOLIPICF705285
   00640 Propanoate metabolism
    PFLUOLIPICF705285
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PFLUOLIPICF705285
Enzymes [BR:pff01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PFLUOLIPICF705285
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PFLUOLIPICF705285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 GARS_A LAL_C2 ATP-grasp_4 MinE Adeno_shaft
Motif
Other DBs
NCBI-ProteinID: AJZ92997
LinkDB All DBs
Position
1136374..1137735
Genome map
AA seq 453 aa AA seqDB search
MLKPAKKLQKVLIANRGEIALRILRACKEEGIKTVAVYSTADTELMHVKLADESICIGPP
LATNSYLKVSNIIAAAEVTGADGIHPGYGFLAENADFAEQVEKSGFAFIGPKAETIRLMG
DKVSAKDAMIAAGVPTVPGSDGPLPEDEETALRIGREVGYPVIIKAAGGGGGRGMRVVHK
EEDLIEAAKQTRSEAGAWFGNPMVYLEKYLTNPRHVEVQVLSDGQGHAIHLGDRDCSLQR
RHQKVLEEAPAPGLDEKARQEVLARCVKACIDINYRGAGTFEFLYENGRFYFIEMNTRVQ
VEHPVSEMVTGIDIVKEMLSIAAGNPLSFTQDDVKMHGHSLECRINAEDPKTFIPSPGLV
KHFHAPGGNGVRVDSHLYSGYKVPSNYDSLIGKLITWGATRDEAMARMRNALDEIVVDGI
KTNIPLHRDLVRDEGFCEGGVNIHYLEHKLANQ
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaacctgcgaagaaactgcaaaaagtcctgatcgccaaccgcggcgagatcgcg
ctgcgtatcctgcgcgcctgtaaggaagagggcatcaagaccgtcgctgtttactcgacg
gccgataccgaattgatgcacgtgaaactggcggacgaaagcatctgcatcggcccgcca
ctggccacgaactcgtacctgaaagtctcgaacatcatcgcggccgcggaagtgaccggc
gccgatggcatccaccctggctatggcttcctcgcggaaaacgccgatttcgccgaacag
gtggaaaaatccgggtttgccttcatcggcccgaaagccgaaaccattcgcctgatgggc
gacaaggtttcggccaaggacgccatgatcgcggctggcgtgccaaccgtgccaggctcc
gacggcccgctgcctgaagacgaggaaaccgctttgcgcattggtcgcgaagtcggttac
ccggtgatcatcaaggccgccggtggcggtggtggtcgcggcatgcgcgtggtgcacaag
gaagaagacctgatcgaagccgccaagcagacccgctccgaagcgggcgcctggttcggc
aacccgatggtctacctggagaagtacctgaccaacccacgtcacgtggaagtccaggta
ctgtccgacggccagggccacgccatccacctgggcgaccgcgattgctcgctgcaacgt
cgtcaccagaaggtcctggaagaagcgccagcaccgggcctggacgaaaaagcgcgccag
gaagtactggctcgttgcgtcaaggcgtgcatcgacatcaactaccgtggcgcgggtact
ttcgagttcctgtacgagaacggtcgtttctacttcatcgagatgaacacgcgcgtgcag
gtagagcacccggtgtcggagatggtcaccggtatcgacatcgtcaaggagatgctcagc
atcgccgccggcaacccgctgtccttcacccaggacgatgtgaagatgcacggccactcc
ctggagtgccgcatcaacgctgaagacccgaaaacctttatcccgagtccaggcctggtc
aagcacttccatgctccgggcggcaacggcgttcgcgtcgattcgcacctgtacagcggc
tacaaggttccgtccaactacgactcgctgatcggcaagctgatcacctggggcgcgacc
cgcgacgaggccatggcccgtatgcgcaacgccctggacgaaatcgtggtcgacggcatc
aagaccaacatcccgctgcatcgggatctggttcgcgatgaaggcttctgcgaaggtggt
gtgaacattcactacctggaacacaaactggccaaccagtaa

DBGET integrated database retrieval system